StarFunc result for job id Q9BXP8

User Input

>input (1791 residues)
MMCLKILRISLAILAGWALCSANSELGWTRKKSLVEREHLNQVLLEGERCWLGAKVRRPR
ASPQHHLFGVYPSRAGNYLRPYPVGEQEIHHTGRSKPDTEGNAVSLVPPDLTENPAGLRG
AVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESLGEAGIQKGSAMAATTTTAIFTTL
NEPKPETQRRGWAKSRQRRQVWKRRAEDGQGDSGISSHFQPWPKHSLKHRVKKSPPEESN
QNGGEGSYREAETFNSQVGLPILYFSGRRERLLLRPEVLAEIPREAFTVEAWVKPEGGQN
NPAIIAGVFDNCSHTVSDKGWALGIRSGKDKGKRDARFFFSLCTDRVKKATILISHSRYQ
PGTWTHVAATYDGRHMALYVDGTQVASSLDQSGPLNSPFMASCRSLLLGGDSSEDGHYFR
GHLGTLVFWSTALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEV
LQGFEPEPEILSPLQPPLCGQTVCDNVELISQYNGYWPLRGEKVIRYQVVNICDDEGLNP
IVSEEQIRLQHEALNEAFSRYNISWQLSVHQVHNSTLRHRVVLVNCEPSKIGNDHCDPEC
EHPLTGYDGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPQVADVRKTCFDPD
SPKRAYMSVKELKEALQLNSTHFLNIYFASSVREDLAGAATWPWDKDAVTHLGGIVLSPA
YYGMPGHTDTMIHEVGHVLGLYHVFKGVSERESCNDPCKETVPSMETGDLCADTAPTPKS
ELCREPEPTSDTCGFTRFPGAPFTNYMSYTDDNCTDNFTPNQVARMHCYLDLVYQQWTES
RKPTPIPIPPMVIGQTNKSLTIHWLPPISGVVYDRASGSLCGACTEDGTFRQYVHTASSR
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPEVHLYHMNMTVPCPTEGCSLELLFQHP
VQADTLTLWVTSFFMESSQVLFDTEILLENKESVHLGPLDTFCDIPLTIKLHVDGKVSGV
KVYTFDERIEIDAALLTSQPHSPLCSGCRPVRYQVLRDPPFASGLPVVVTHSHRKFTDVE
VTPGQMYQYQVLAEAGGELGEASPPLNHIHGAPYCGDGKVSERLGEECDDGDLVSGDGCS
KVCELEEGFNCVGEPSLCYMYEGDGICEPFERKTSIVDCGIYTPKGYLDQWATRAYSSHE
DKKKCPVSLVTGEPHSLICTSYHPDLPNHRPLTGWFPCVASENETQDDRSEQPEGSLKKE
DEVWLKVCFNRPGEARAIFIFLTTDGLVPGEHQQPTVTLYLTDVRGSNHSLGTYGLSCQH
NPLIINVTHHQNVLFHHTTSVLLNFSSPRVGISAVALRTSSRIGLSAPSNCISEDEGQNH
QGQSCIHRPCGKQDSCPSLLLDHADVVNCTSIGPGLMKCAITCQRGFALQASSGQYIRPM
QKEILLTCSSGHWDQNVSCLPVDCGVPDPSLVNYANFSCSEGTKFLKRCSISCVPPAKLQ
GLSPWLTCLEDGLWSLPEVYCKLECDAPPIILNANLLLPHCLQDNHDVGTICKYECKPGY
YVAESAEGKVRNKLLKIQCLEGGIWEQGSCIPVVCEPPPPVFEGMYECTNGFSLDSQCVL
NCNQEREKLPILCTKEGLWTQEFKLCENLQGECPPPPSELNSVEYKCEQGYGIGAVCSPL
CVIPPSDPVMLPENITADTLEHWMEPVKVQSIVCTGRRQWHPDPVLVHCIQSCEPFQADG
WCDTINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7ufgA	0.509	0.776	0.000	1151	0.299	0.465	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
2	PDB:7ufgB	0.534	0.797	0.000	1182	0.310	0.470	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
3	PDB:8a7eC	0.526	0.611	0.000	1524	0.395	0.465	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
4	AFDB:E9PZ87	0.893	0.894	0.000	1789	0.791	0.792	E9PZ87.pdb.gz	E9PZ87_MOUSE Pappalysin 2 OS=Mus musculus OX=10090 GN=Pappa2 PE=1 SV=1
5	AFDB:F1Q5Q4	0.778	0.853	0.000	1624	0.404	0.445	F1Q5Q4.pdb.gz
6	AFDB:Q9BXP8	1.000	1.000	0.000	1791	1.000	1.000	Q9BXP8.pdb.gz	PAPP2_HUMAN Pappalysin-2 OS=Homo sapiens OX=9606 GN=PAPPA2 PE=1 SV=4
7	PDB:8a7dQ	0.146	0.864	8.729E-32	273	0.073	0.476	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
8	PDB:2gsxA	0.063	0.095	6.419E-14	951	0.054	0.102	2gsxA.pdb.gz
9	PDB:1c1zA	0.092	0.291	2.023E-12	326	0.032	0.175	1c1zA.pdb.gz
10	PDB:2q7zA	0.077	0.073	1.442E-11	1931	0.058	0.053	2q7zA.pdb.gz
11	PDB:1haqA	0.092	0.127	5.619E-10	1213	0.055	0.082	1haqA.pdb.gz
12	AFDB:Q9BYH1	0.066	0.097	2.076E-9	1024	0.093	0.163	Q9BYH1.pdb.gz	SE6L1_HUMAN Seizure 6-like protein OS=Homo sapiens OX=9606 GN=SEZ6L PE=1 SV=1
13	PDB:7zl1A	0.095	0.664	6.810E-9	215	0.020	0.167	7zl1A.pdb.gz
14	PDB:4pbpB	0.092	0.629	4.058E-7	210	0.021	0.176	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
15	AFDB:B7YZW3	0.049	0.044	2.688E-6	2064	0.086	0.075	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
16	AFDB:Q20684	0.057	0.079	1.746E-3	1245	0.029	0.042	Q20684.pdb.gz	Q20684_CAEEL Galectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lec-2 PE=1 SV=2
17	AFDB:Q59FP8	0.041	0.057	1.061E-2	1130	0.043	0.068	Q59FP8.pdb.gz	Q59FP8_HUMAN Neogenin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=1
18	AFDB:Q90X47	0.052	0.048	2.231E-2	2101	0.087	0.074	Q90X47.pdb.gz
19	AFDB:P12259	0.058	0.051	9.353E-2	2224	0.071	0.058	P12259.pdb.gz	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4
20	AFDB:Q99K31	0.023	0.045	1.590E-1	616	0.025	0.071	Q99K31.pdb.gz	Q99K31_MOUSE Col6a3 protein (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MJG5	0.0	1387	1502	0.389	0.463	A0A096MJG5_RAT Pappalysin 1 OS=Rattus norvegicus OX=10116 GN=Pappa PE=3 SV=1
2	A0A096MK86	0.0	1395	1623	0.386	0.426	A0A096MK86_RAT Pappalysin 1 OS=Rattus norvegicus OX=10116 GN=Pappa PE=3 SV=2
3	A0A0G2JU68	0.0	2934	1788	0.795	0.796	A0A0G2JU68_RAT Pappalysin 2 OS=Rattus norvegicus OX=10116 GN=Pappa2 PE=3 SV=2
4	E9PZ87	0.0	2914	1789	0.792	0.793	E9PZ87_MOUSE Pappalysin 2 OS=Mus musculus OX=10090 GN=Pappa2 PE=1 SV=1
5	E9QCK7	0.0	1701	1731	0.495	0.512	E9QCK7_DANRE Papp-a2 (Fragment) OS=Danio rerio OX=7955 GN=papp-a2 PE=3 SV=1
6	M1WXG8	0.0	1438	1624	0.404	0.445	M1WXG8_DANRE Pregnancy-associated plasma protein A, pappalysin 1b precursor OS=Danio rerio OX=7955 GN=papp-ab PE=2 SV=1
7	M1XYM1	0.0	1382	1629	0.406	0.447	M1XYM1_DANRE Pappalysin-1 precursor OS=Danio rerio OX=7955 GN=papp-aa PE=2 SV=1
8	Q13219	0.0	1453	1627	0.397	0.437	PAPP1_HUMAN Pappalysin-1 OS=Homo sapiens OX=9606 GN=PAPPA PE=1 SV=3
9	Q505G3	0.0	737	448	0.210	0.839	Q505G3_MOUSE Pappa2 protein OS=Mus musculus OX=10090 GN=Pappa2 PE=2 SV=1
10	Q8BJG6	0.0	1972	1214	0.535	0.790	Q8BJG6_MOUSE Pappalysin 2 (Fragment) OS=Mus musculus OX=10090 GN=Pappa2 PE=2 SV=1
11	Q8R4K8	0.0	1472	1624	0.407	0.449	PAPP1_MOUSE Pappalysin-1 OS=Mus musculus OX=10090 GN=Pappa PE=2 SV=2
12	Q9BXP8	0.0	3712	1791	1.000	1.000	PAPP2_HUMAN Pappalysin-2 OS=Homo sapiens OX=9606 GN=PAPPA2 PE=1 SV=4
13	F6TFC9	3.37e-107	343	246	0.099	0.724	F6TFC9_MOUSE Pappalysin 2 (Fragment) OS=Mus musculus OX=10090 GN=Pappa2 PE=1 SV=2
14	A0A8I5ZQD6	3.39e-27	108	69	0.028	0.725	A0A8I5ZQD6_RAT Pappalysin 2 OS=Rattus norvegicus OX=10116 GN=Pappa2 PE=4 SV=1
15	Q61475	8.82e-10	65.1	390	0.031	0.141	DAF1_MOUSE Complement decay-accelerating factor, GPI-anchored OS=Mus musculus OX=10090 GN=Cd55 PE=1 SV=2
16	P08174	1.09e-08	61.6	381	0.034	0.160	DAF_HUMAN Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55 PE=1 SV=4
17	A0A1D5NSM8	1.53e-08	62.8	3615	0.040	0.020	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
18	Q00690	4.32e-08	60.5	612	0.041	0.119	LYAM2_MOUSE E-selectin OS=Mus musculus OX=10090 GN=Sele PE=2 SV=1
19	P98106	8.23e-08	59.7	768	0.038	0.089	LYAM3_RAT P-selectin OS=Rattus norvegicus OX=10116 GN=Selp PE=2 SV=1
20	Q4LDE5	1.11e-07	59.7	3571	0.040	0.020	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13948 DUF4215	0.33	22.7	Domain of unknown function (DUF4215)
2	PF16313 DUF4953	1.3e+02	13.2	Met-zincin
3	PF00054 Laminin_G_1	1.2e+02	14.4	Laminin G domain
4	PF02210 Laminin_G_2	2.8	19.9	Laminin G domain
5	PF13385 Laminin_G_3	8.6e-19	79.6	Concanavalin A-like lectin/glucanases superfamily
6	PF00066 Notch	0.023	26.4	LNR domain
7	PF05572 Peptidase_M43	5.6e-05	34.6	Pregnancy-associated plasma protein-A
8	PF13582 Reprolysin_3	1.1e+02	14.7	Metallo-peptidase family M12B Reprolysin-like
9	PF00084 Sushi	0.0011	30.7	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356634

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233813	0.979	Insulin-like growth factor-binding protein 5
2	9606.ENSP00000269593	0.959	Insulin-like growth factor-binding protein 4
3	9606.ENSP00000302665	0.957	Insulin-like growth factor I
4	9606.ENSP00000391826	0.939	Insulin-like growth factor II
5	9606.ENSP00000416683	0.929	Insulin-like growth factor-binding protein complex acid labile subunit
6	9606.ENSP00000370473	0.633	Insulin-like growth factor-binding protein 3
7	9606.ENSP00000401502	0.558	Sialic acid-binding Ig-like lectin 6
8	9606.ENSP00000350630	0.542	Tolloid-like protein 2
9	9606.ENSP00000343674	0.518	Astacin-like metalloendopeptidase
10	9606.ENSP00000230588	0.505	Meprin A subunit alpha
11	9606.ENSP00000369604	0.504	F-box only protein 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	0.999	metalloendopeptidase activity
GO:0005488	0.827	binding
GO:0005515	0.592	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.912	organic substance metabolic process
GO:0044238	0.883	primary metabolic process
GO:0043170	0.824	macromolecule metabolic process
GO:0006807	0.821	nitrogen compound metabolic process
GO:0050896	0.777	response to stimulus
GO:1901564	0.767	organonitrogen compound metabolic process
GO:0019538	0.748	protein metabolic process
GO:0032501	0.705	multicellular organismal process
GO:0065007	0.592	biological regulation
GO:0050789	0.566	regulation of biological process
GO:0009987	0.550	cellular process
GO:0050794	0.503	regulation of cellular process
GO:0006508	0.472	proteolysis
GO:0032502	0.435	developmental process
GO:0048856	0.430	anatomical structure development
GO:0007275	0.338	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043227	0.997	membrane-bounded organelle
GO:0031982	0.952	vesicle
GO:0005615	0.885	extracellular space
GO:0005622	0.816	intracellular anatomical structure
GO:0043231	0.761	intracellular membrane-bounded organelle
GO:0005737	0.717	cytoplasm
GO:0070062	0.685	extracellular exosome
GO:0071944	0.475	cell periphery
GO:0016020	0.474	membrane
GO:0005886	0.431	plasma membrane
GO:0012505	0.353	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	0.999	Metalloendopeptidases.

[back to server]