StarFunc result for job id Q9BXR5

User Input

>input (811 residues)
MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLL
FQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLR
YLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHY
EEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLE
NAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMR
TIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNIL
TDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP
ETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTD
LPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYS
EVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLH
FDLPWYLRMLGQCTQTWHRVRKTTQEQLKRNVRFHAFISYSEHDSLWVKNELIPNLEKED
GSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNFVQNEWCHYEFYFAHHNLFHE
NSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLFWANLRAAINVNVL
ATREMYELQTFTELNEESRGSTISLMRTDCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXR5	1.000	1.000	0.000	811	1.000	1.000	Q9BXR5.pdb.gz	TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens OX=9606 GN=TLR10 PE=1 SV=2
2	AFDB:Q15399	0.771	0.793	7.153E-72	786	0.476	0.491	Q15399.pdb.gz	TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens OX=9606 GN=TLR1 PE=1 SV=3
3	AFDB:Q9EPQ1	0.802	0.817	2.335E-70	795	0.481	0.491	Q9EPQ1.pdb.gz	TLR1_MOUSE Toll-like receptor 1 OS=Mus musculus OX=10090 GN=Tlr1 PE=1 SV=1
4	AFDB:F6SU23	0.666	0.660	1.020E-69	818	0.485	0.480	F6SU23.pdb.gz
5	AFDB:E9PTL5	0.835	0.863	3.261E-69	783	0.480	0.497	E9PTL5.pdb.gz	E9PTL5_RAT Toll-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Tlr1 PE=3 SV=3
6	AFDB:Q9Y2C9	0.763	0.776	2.172E-65	796	0.457	0.466	Q9Y2C9.pdb.gz	TLR6_HUMAN Toll-like receptor 6 OS=Homo sapiens OX=9606 GN=TLR6 PE=1 SV=2
7	AFDB:Q9EPW9	0.823	0.839	5.186E-64	795	0.450	0.459	Q9EPW9.pdb.gz	TLR6_MOUSE Toll-like receptor 6 OS=Mus musculus OX=10090 GN=Tlr6 PE=1 SV=2
8	AFDB:G3V695	0.673	0.673	2.710E-63	811	0.440	0.440	G3V695.pdb.gz	G3V695_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
9	AFDB:A5H0S2	0.458	0.562	2.041E-49	652	0.354	0.440	A5H0S2.pdb.gz	A5H0S2_CHICK Toll-like receptor 1-like protein b OS=Gallus gallus OX=9031 GN=TLR1Lb PE=2 SV=1
10	AFDB:E9PTD9	0.569	0.586	6.356E-46	784	0.297	0.307	E9PTD9.pdb.gz	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
11	PDB:3j0aA	0.378	0.383	6.013E-23	797	0.184	0.187	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
12	PDB:7wv3A	0.397	0.459	6.088E-14	668	0.147	0.178	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:3t6qA	0.418	0.544	5.687E-13	601	0.133	0.180	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:7tvfD	0.319	0.467	3.795E-11	515	0.132	0.208	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
15	PDB:3b2dA	0.383	0.478	1.450E-10	601	0.143	0.193	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:6gffI	0.334	0.452	1.450E-10	551	0.127	0.187	6gffI.pdb.gz
17	PDB:7wrqA	0.281	0.370	4.518E-7	566	0.128	0.184	7wrqA.pdb.gz
18	PDB:2ft3F	0.153	0.377	6.598E-6	305	0.089	0.236	2ft3F.pdb.gz
19	PDB:7y1rE	0.255	0.398	1.180E-5	428	0.120	0.227	7y1rE.pdb.gz
20	PDB:7p5vB	0.248	0.270	1.290E-5	732	0.086	0.096	7p5vB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MKA9	0.0	700	806	0.459	0.462	A0A096MKA9_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
2	A5H0S2	0.0	548	652	0.358	0.445	A5H0S2_CHICK Toll-like receptor 1-like protein b OS=Gallus gallus OX=9031 GN=TLR1Lb PE=2 SV=1
3	E9PTL5	0.0	738	808	0.480	0.481	E9PTL5_RAT Toll-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Tlr1 PE=3 SV=3
4	G3V695	0.0	681	811	0.451	0.451	G3V695_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
5	Q15399	0.0	742	786	0.483	0.499	TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens OX=9606 GN=TLR1 PE=1 SV=3
6	Q5WA51	0.0	709	818	0.483	0.479	Q5WA51_CHICK Toll-like receptor 1 OS=Gallus gallus OX=9031 GN=TLR1 PE=2 SV=1
7	Q6P690	0.0	700	806	0.459	0.462	Q6P690_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=2 SV=1
8	Q9BXR5	0.0	1674	811	1.000	1.000	TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens OX=9606 GN=TLR10 PE=1 SV=2
9	Q9EPQ1	0.0	747	795	0.488	0.498	TLR1_MOUSE Toll-like receptor 1 OS=Mus musculus OX=10090 GN=Tlr1 PE=1 SV=1
10	Q9EPW9	0.0	689	795	0.459	0.468	TLR6_MOUSE Toll-like receptor 6 OS=Mus musculus OX=10090 GN=Tlr6 PE=1 SV=2
11	Q9Y2C9	0.0	726	796	0.471	0.480	TLR6_HUMAN Toll-like receptor 6 OS=Homo sapiens OX=9606 GN=TLR6 PE=1 SV=2
12	Q9QUN7	1.22e-104	342	784	0.300	0.310	TLR2_MOUSE Toll-like receptor 2 OS=Mus musculus OX=10090 GN=Tlr2 PE=1 SV=1
13	Q9DD78	4.86e-99	327	793	0.291	0.298	TLR21_CHICK Toll-like receptor 2 type-1 OS=Gallus gallus OX=9031 GN=TLR2-1 PE=2 SV=1
14	O60603	1.05e-97	323	784	0.296	0.306	TLR2_HUMAN Toll-like receptor 2 OS=Homo sapiens OX=9606 GN=TLR2 PE=1 SV=1
15	Q6YGU2	4.19e-96	319	784	0.308	0.319	Q6YGU2_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=2 SV=1
16	E9PTD9	1.10e-95	318	784	0.308	0.319	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
17	Q6TS42	1.56e-79	274	788	0.282	0.291	Q6TS42_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=2 SV=1
18	F1QWS9	1.66e-79	275	818	0.282	0.280	F1QWS9_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=3 SV=1
19	Q2XQ10	4.68e-50	192	868	0.173	0.161	Q2XQ10_CHICK Toll-like receptor 2 OS=Gallus gallus OX=9031 GN=TLR15 PE=2 SV=1
20	A0A2R8RTN4	2.18e-38	156	955	0.138	0.117	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01463 LRRCT	2.9	19.7	Leucine rich repeat C-terminal domain
2	PF00560 LRR_1	0.0014	29.6	Leucine Rich Repeat
3	PF12799 LRR_4	6.4e-13	59.9	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	0.097	23.8	Leucine Rich repeat
5	PF13855 LRR_8	9.6e-19	78.2	Leucine rich repeat
6	PF14580 LRR_9	4.4e+02	11.8	Leucine-rich repeat
7	PF01582 TIR	9.9e-20	82.6	TIR domain
8	PF13676 TIR_2	1.5e-09	49.9	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308925

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401399	0.964	Myeloid differentiation primary response protein MyD88
2	9606.ENSP00000385675	0.744	Interleukin-6
3	9606.ENSP00000398698	0.720	Tumor necrosis factor
4	9606.ENSP00000412237	0.710	Interleukin-10
5	9606.ENSP00000011653	0.645	T-cell surface glycoprotein CD4
6	9606.ENSP00000376445	0.629	Toll/interleukin-1 receptor domain-containing adapter protein
7	9606.ENSP00000260010	0.624	Toll-like receptor 2
8	9606.ENSP00000284818	0.610	Lymphocyte antigen 96
9	9606.ENSP00000390651	0.606	Interleukin-1 receptor-associated kinase 4
10	9606.ENSP00000332049	0.586	T-lymphocyte activation antigen CD86
11	9606.ENSP00000264246	0.584	T-lymphocyte activation antigen CD80
12	9606.ENSP00000280357	0.582	Interleukin-18
13	9606.ENSP00000231449	0.575	Interleukin-4
14	9606.ENSP00000358997	0.570	Interleukin-1 receptor-associated kinase 1
15	9606.ENSP00000441691	0.569	Integrin alpha-M
16	9606.ENSP00000361359	0.568	Tumor necrosis factor receptor superfamily member 5
17	9606.ENSP00000433623	0.567	TNF receptor-associated factor 6
18	9606.ENSP00000337383	0.566	NACHT, LRR and PYD domains-containing protein 3
19	9606.ENSP00000451828	0.565	RAC-alpha serine/threonine-protein kinase
20	9606.ENSP00000263341	0.559	Interleukin-1 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0004888	0.999	transmembrane signaling receptor activity
GO:0042277	0.906	peptide binding
GO:0005102	0.814	signaling receptor binding
GO:0008289	0.794	lipid binding
GO:0071723	0.306	lipopeptide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0050794	0.998	regulation of cellular process
GO:0023052	0.996	signaling
GO:0007154	0.996	cell communication
GO:0002376	0.995	immune system process
GO:0002682	0.995	regulation of immune system process
GO:0048584	0.995	positive regulation of response to stimulus
GO:0002684	0.994	positive regulation of immune system process
GO:0032101	0.992	regulation of response to external stimulus
GO:0031347	0.990	regulation of defense response
GO:0050776	0.987	regulation of immune response
GO:0007165	0.987	signal transduction
GO:0002833	0.984	positive regulation of response to biotic stimulus
GO:0031349	0.981	positive regulation of defense response
GO:0002253	0.980	activation of immune response
GO:0032103	0.979	positive regulation of response to external stimulus
GO:0009605	0.977	response to external stimulus
GO:0042221	0.972	response to chemical
GO:0002221	0.971	pattern recognition receptor signaling pathway
GO:0044419	0.960	biological process involved in interspecies interaction between organisms
GO:0009607	0.952	response to biotic stimulus
GO:0051707	0.941	response to other organism
GO:0009617	0.917	response to bacterium
GO:0010033	0.885	response to organic substance
GO:0006952	0.884	defense response
GO:0019222	0.877	regulation of metabolic process
GO:0045321	0.874	leukocyte activation
GO:0060255	0.855	regulation of macromolecule metabolic process
GO:0048522	0.850	positive regulation of cellular process
GO:0009893	0.845	positive regulation of metabolic process
GO:0002224	0.839	toll-like receptor signaling pathway
GO:0010468	0.799	regulation of gene expression
GO:0010604	0.797	positive regulation of macromolecule metabolic process
GO:0051239	0.784	regulation of multicellular organismal process
GO:0031323	0.632	regulation of cellular metabolic process
GO:0051171	0.626	regulation of nitrogen compound metabolic process
GO:0051240	0.614	positive regulation of multicellular organismal process
GO:0023051	0.573	regulation of signaling
GO:0010646	0.571	regulation of cell communication
GO:0001817	0.565	regulation of cytokine production
GO:0006954	0.562	inflammatory response
GO:0002237	0.561	response to molecule of bacterial origin
GO:0009966	0.557	regulation of signal transduction
GO:0001819	0.526	positive regulation of cytokine production
GO:0070887	0.488	cellular response to chemical stimulus
GO:0006955	0.469	immune response
GO:0080090	0.469	regulation of primary metabolic process
GO:0051173	0.416	positive regulation of nitrogen compound metabolic process
GO:0009967	0.400	positive regulation of signal transduction
GO:0031326	0.377	regulation of cellular biosynthetic process
GO:0071310	0.368	cellular response to organic substance
GO:0048519	0.349	negative regulation of biological process
GO:0031325	0.345	positive regulation of cellular metabolic process
GO:0048523	0.326	negative regulation of cellular process
GO:1903506	0.325	regulation of nucleic acid-templated transcription
GO:0006355	0.324	regulation of DNA-templated transcription
GO:0008152	0.315	metabolic process
GO:1901700	0.309	response to oxygen-containing compound
GO:1902531	0.302	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.982	protein-containing complex
GO:0005737	0.841	cytoplasm
GO:0043235	0.840	receptor complex
GO:0043231	0.774	intracellular membrane-bounded organelle
GO:0012505	0.392	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]