StarFunc result for job id Q9BXS1

User Input

>input (227 residues)
MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFN
TKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPG
EQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELW
ELLEREARGEVKVTPWLRTIAERFLYRWWPHLDDVTPFVELHKIHRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXS1	1.000	1.000	1.273E-51	227	1.000	1.000	Q9BXS1.pdb.gz	IDI2_HUMAN Isopentenyl-diphosphate delta-isomerase 2 OS=Homo sapiens OX=9606 GN=IDI2 PE=1 SV=1
2	PDB:2pnyA	0.987	0.962	1.541E-46	233	1.000	0.974	2pnyA.pdb.gz	Structure of the human Isopentenyl-diphosphate Delta-isomerase 2.
3	AFDB:Q8BFZ6	0.981	0.981	1.741E-39	227	0.656	0.656	Q8BFZ6.pdb.gz	IDI2_MOUSE Isopentenyl-diphosphate delta-isomerase 2 OS=Mus musculus OX=10090 GN=Idi2 PE=2 SV=1
4	AFDB:Q13907	0.981	0.981	3.038E-39	227	0.648	0.648	Q13907.pdb.gz	IDI1_HUMAN Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens OX=9606 GN=IDI1 PE=1 SV=2
5	AFDB:O35586	0.980	0.980	7.218E-39	227	0.621	0.621	O35586.pdb.gz	IDI1_MESAU Isopentenyl-diphosphate Delta-isomerase 1 OS=Mesocricetus auratus OX=10036 GN=IDI1 PE=2 SV=1
6	PDB:2i6kA	0.971	0.983	3.004E-37	224	0.639	0.647	2i6kA.pdb.gz	Crystal structures of human IPP isomerase: new insights into the catalytic mechanism
7	AFDB:Q38929	0.973	0.762	1.301E-32	291	0.480	0.375	Q38929.pdb.gz	IDI1_ARATH Isopentenyl-diphosphate Delta-isomerase I, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPP1 PE=1 SV=3
8	AFDB:Q42553	0.969	0.778	4.414E-31	284	0.467	0.373	Q42553.pdb.gz	IDI2_ARATH Isopentenyl-diphosphate Delta-isomerase II, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPP2 PE=1 SV=1
9	AFDB:Q10132	0.931	0.923	6.702E-30	229	0.423	0.419	Q10132.pdb.gz	IDI1_SCHPO Isopentenyl-diphosphate delta-isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=idi1 PE=2 SV=2
10	AFDB:P15496	0.895	0.710	7.710E-27	288	0.414	0.326	P15496.pdb.gz	IDI1_YEAST Isopentenyl-diphosphate delta-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDI1 PE=1 SV=2
11	AFDB:Q46822	0.666	0.815	1.785E-12	182	0.207	0.258	Q46822.pdb.gz	IDI_ECOLI Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli (strain K12) OX=83333 GN=idi PE=1 SV=1
12	PDB:2b2kB	0.630	0.777	6.663E-12	180	0.216	0.272	2b2kB.pdb.gz	Structural role for Tyr-104 in Escherichia coli isopentenyl-diphosphate isomerase: site-directed mutagenesis, enzymology, and protein crystallography
13	AFDB:Q8L831	0.608	0.190	2.395E-11	772	0.172	0.051	Q8L831.pdb.gz	NUDT3_ARATH Nudix hydrolase 3 OS=Arabidopsis thaliana OX=3702 GN=NUDT3 PE=1 SV=1
14	PDB:2fkbC	0.568	0.748	2.441E-11	167	0.172	0.234	2fkbC.pdb.gz
15	PDB:1vc8A	0.386	0.625	6.086E-6	126	0.115	0.206	1vc8A.pdb.gz	Crystal Structure of Nudix Protein Ndx1 from Thermus thermophilus HB8 in binary complex with diadenosine hexaphosphate
16	PDB:7b66A	0.405	0.550	8.819E-6	161	0.115	0.161	7b66A.pdb.gz	Crystal structures of NUDT15 variants enabled by a potent inhibitor reveal the structural basis for thiopurine sensitivity.
17	PDB:5louB	0.458	0.360	1.129E-5	301	0.115	0.086	5louB.pdb.gz	Human NUDT22 Is a UDP-Glucose/Galactose Hydrolase Exhibiting a Unique Structural Fold.
18	PDB:5t3pC	0.357	0.365	1.278E-5	221	0.093	0.095	5t3pC.pdb.gz
19	PDB:5gp0I	0.380	0.585	1.741E-5	139	0.119	0.194	5gp0I.pdb.gz	Structural Insights into the Substrate Recognition Mechanism of Arabidopsis GPP-Bound NUDX1 for Noncanonical Monoterpene Biosynthesis.
20	PDB:1ktgA	0.365	0.551	1.852E-5	137	0.110	0.182	1ktgA.pdb.gz	The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXS1	2.53e-170	469	227	1.000	1.000	IDI2_HUMAN Isopentenyl-diphosphate delta-isomerase 2 OS=Homo sapiens OX=9606 GN=IDI2 PE=1 SV=1
2	Q8BFZ6	2.86e-110	317	227	0.652	0.652	IDI2_MOUSE Isopentenyl-diphosphate delta-isomerase 2 OS=Mus musculus OX=10090 GN=Idi2 PE=2 SV=1
3	O35760	4.37e-109	314	227	0.626	0.626	IDI1_RAT Isopentenyl-diphosphate Delta-isomerase 1 OS=Rattus norvegicus OX=10116 GN=Idi1 PE=2 SV=2
4	O35586	2.57e-107	310	227	0.621	0.621	IDI1_MESAU Isopentenyl-diphosphate Delta-isomerase 1 OS=Mesocricetus auratus OX=10036 GN=IDI1 PE=2 SV=1
5	P58044	3.52e-106	307	227	0.608	0.608	IDI1_MOUSE Isopentenyl-diphosphate Delta-isomerase 1 OS=Mus musculus OX=10090 GN=Idi1 PE=1 SV=1
6	Q13907	2.12e-105	305	227	0.648	0.648	IDI1_HUMAN Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens OX=9606 GN=IDI1 PE=1 SV=2
7	Q38929	2.43e-67	211	291	0.480	0.375	IDI1_ARATH Isopentenyl-diphosphate Delta-isomerase I, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPP1 PE=1 SV=3
8	Q42553	6.24e-67	209	284	0.476	0.380	IDI2_ARATH Isopentenyl-diphosphate Delta-isomerase II, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPP2 PE=1 SV=1
9	Q10132	2.36e-57	183	229	0.423	0.419	IDI1_SCHPO Isopentenyl-diphosphate delta-isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=idi1 PE=2 SV=2
10	P15496	6.56e-52	171	288	0.410	0.323	IDI1_YEAST Isopentenyl-diphosphate delta-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDI1 PE=1 SV=2
11	Q46822	2.65e-07	51.2	182	0.159	0.198	IDI_ECOLI Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli (strain K12) OX=83333 GN=idi PE=1 SV=1
12	Q8PTX6	0.001	40.8	170	0.101	0.135	PRDPP_METMA Prenyl-diphosphate phosphatase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=MM_2582 PE=1 SV=1
13	Q8L831	0.24	34.7	772	0.167	0.049	NUDT3_ARATH Nudix hydrolase 3 OS=Arabidopsis thaliana OX=3702 GN=NUDT3 PE=1 SV=1
14	P65556	0.77	32.3	180	0.093	0.117	YFCD_ECOLI Uncharacterized Nudix hydrolase YfcD OS=Escherichia coli (strain K12) OX=83333 GN=yfcD PE=1 SV=1
15	B4DLR9	1.5	31.2	148	0.075	0.115	B4DLR9_HUMAN cDNA FLJ53804, highly similar to Nucleoside diphosphate-linked moiety X motif 16 OS=Homo sapiens OX=9606 PE=1 SV=1
16	O13872	2.0	31.6	248	0.203	0.185	VPS28_SCHPO Vacuolar protein sorting-associated protein 28 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps28 PE=3 SV=1
17	P43772	5.9	29.6	175	0.057	0.074	HSLV_HAEIN ATP-dependent protease subunit HslV OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=hslV PE=1 SV=2
18	Q947D2	9.0	30.0	1103	0.115	0.024	PRAF1_ARATH PH, RCC1 and FYVE domains-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PRAF1 PE=1 SV=1
19	Q8VEM1	9.6	29.6	419	0.044	0.024	GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus OX=10090 GN=Rnf130 PE=2 SV=1
20	Q0KHU5	9.7	29.6	533	0.062	0.026	PCAT_DROME Lysophosphatidylcholine acyltransferase OS=Drosophila melanogaster OX=7227 GN=LPCAT PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00293 NUDIX	6.9e-16	69.9	NUDIX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000277517

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301012	0.981	Diphosphomevalonate decarboxylase
2	9606.ENSP00000349078	0.980	Farnesyl pyrophosphate synthase
3	9606.ENSP00000282841	0.977	Geranylgeranyl pyrophosphate synthase
4	9606.ENSP00000265896	0.888	Squalene monooxygenase
5	9606.ENSP00000290759	0.878	Insulin gene enhancer protein ISL-2
6	9606.ENSP00000392466	0.878	LIM domain-binding protein 1
7	9606.ENSP00000483921	0.878	Single stranded DNA binding protein 2
8	9606.ENSP00000360371	0.877	Single-stranded DNA-binding protein 3
9	9606.ENSP00000287936	0.875	3-hydroxy-3-methylglutaryl-coenzyme A reductase
10	9606.ENSP00000359575	0.872	LIM domain transcription factor LMO4
11	9606.ENSP00000480828	0.863	Squalene synthase
12	9606.ENSP00000443551	0.837	Mevalonate kinase
13	9606.ENSP00000370748	0.808	Isopentenyl-diphosphate Delta-isomerase 1
14	9606.ENSP00000347684	0.786	LIM homeobox transcription factor 1-beta
15	9606.ENSP00000270061	0.752	Single stranded DNA binding protein 4
16	9606.ENSP00000322706	0.750	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
17	9606.ENSP00000380837	0.740	Lanosterol synthase
18	9606.ENSP00000358414	0.715	Hydroxymethylglutaryl-CoA synthase, mitochondrial
19	9606.ENSP00000357452	0.646	Phosphomevalonate kinase
20	9606.ENSP00000254521	0.628	3-keto-steroid reductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004452	1.000	isopentenyl-diphosphate delta-isomerase activity
GO:0043167	0.367	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0008610	0.991	lipid biosynthetic process
GO:0044237	0.979	cellular metabolic process
GO:0044255	0.924	cellular lipid metabolic process
GO:0044249	0.902	cellular biosynthetic process
GO:0006720	0.796	isoprenoid metabolic process
GO:0006793	0.589	phosphorus metabolic process
GO:0019637	0.561	organophosphate metabolic process
GO:0006796	0.466	phosphate-containing compound metabolic process
GO:0006644	0.429	phospholipid metabolic process
GO:0065007	0.416	biological regulation
GO:1901360	0.375	organic cyclic compound metabolic process
GO:0008299	0.372	isoprenoid biosynthetic process
GO:0050789	0.343	regulation of biological process
GO:1901617	0.322	organic hydroxy compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.982	cytosol
GO:0005777	0.899	peroxisome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23284	1.000	isopentenyl diphosphate = dimethylallyl diphosphate
EC:5.3.3.2	1.000	isopentenyl-diphosphate Delta-isomerase.

[back to server]