StarFunc result for job id Q9BXS4

User Input

>input (323 residues)
MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHT
YPKEEELYACQRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQ
LPFAELRQEQLMSLMPKMHLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIF
QSKPEIQYAPHLEQEPTNLRESSLSKMSYLQMRNSQAHRNFLEDGESDGFLRCLSLNSGW
ILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGDLEFMNEQKLNRYPASSLVVVR
SKTEDHEEAGPLPTKVNLAHSEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXS4	1.000	1.000	2.823E-51	323	1.000	1.000	Q9BXS4.pdb.gz	TMM59_HUMAN Transmembrane protein 59 OS=Homo sapiens OX=9606 GN=TMEM59 PE=1 SV=1
2	AFDB:A8WG81	0.358	0.344	8.760E-21	339	0.399	0.381	A8WG81.pdb.gz	A8WG81_DANRE Transmembrane protein 59-like OS=Danio rerio OX=7955 GN=wu:fi68e12 PE=2 SV=1
3	AFDB:Q7TNI2	0.271	0.261	2.414E-16	337	0.331	0.318	Q7TNI2.pdb.gz	TM59L_MOUSE Transmembrane protein 59-like OS=Mus musculus OX=10090 GN=Tmem59l PE=2 SV=1
4	AFDB:Q9UK28	0.253	0.240	2.150E-15	342	0.328	0.310	Q9UK28.pdb.gz	TM59L_HUMAN Transmembrane protein 59-like OS=Homo sapiens OX=9606 GN=TMEM59L PE=2 SV=1
5	AFDB:Q386C1	0.116	0.103	5.703E-2	395	0.183	0.149	Q386C1.pdb.gz	Q386C1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1430 PE=4 SV=1
6	AFDB:D3ZZH6	0.128	0.040	1.557E-1	1379	0.108	0.025	D3ZZH6.pdb.gz	D3ZZH6_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=4
7	AFDB:Q9CSP9	0.136	0.075	2.093E-1	761	0.108	0.046	Q9CSP9.pdb.gz	TTC14_MOUSE Tetratricopeptide repeat protein 14 OS=Mus musculus OX=10090 GN=Ttc14 PE=1 SV=3
8	AFDB:Q9VDS9	0.125	0.038	2.651E-1	1363	0.099	0.023	Q9VDS9.pdb.gz	Q9VDS9_DROME Apoptotic signal-regulating kinase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=1 SV=3
9	AFDB:Q9V9Y9	0.102	0.094	4.009E-1	364	0.149	0.132	Q9V9Y9.pdb.gz	SPNF_DROME Protein spindle-F OS=Drosophila melanogaster OX=7227 GN=spn-F PE=1 SV=1
10	AFDB:A8MQN4	0.092	0.059	5.388E-1	528	0.071	0.044	A8MQN4.pdb.gz	A8MQN4_ARATH Calcineurin-like metallo-phosphoesterase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g53710 PE=1 SV=1
11	PDB:8a5yT	0.099	0.062	1.080	650	0.080	0.040	8a5yT.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex and comparison to apo unphosphorylated and phosphorylated states
12	PDB:6wq2A	0.114	0.188	1.368	154	0.077	0.162	6wq2A.pdb.gz	Structures of filamentous viruses infecting hyperthermophilic archaea explain DNA stabilization in extreme environments.
13	PDB:2byvE	0.090	0.040	1.451	922	0.065	0.023	2byvE.pdb.gz
14	PDB:7l08a	0.066	0.186	1.540	108	0.040	0.120	7l08a.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
15	PDB:1yo7A	0.132	0.266	1.633	120	0.050	0.133	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
16	PDB:3zqqC	0.107	0.199	1.633	134	0.056	0.134	3zqqC.pdb.gz
17	PDB:7ky1A	0.111	0.168	1.733	189	0.043	0.074	7ky1A.pdb.gz
18	PDB:6ytvA	0.112	0.123	1.838	252	0.077	0.099	6ytvA.pdb.gz
19	PDB:1a6rA	0.101	0.075	1.950	459	0.043	0.031	1a6rA.pdb.gz
20	PDB:5iqr8	0.103	0.061	2.069	615	0.031	0.016	5iqr8.pdb.gz	Ribosome-dependent activation of stringent control.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXS4	0.0	672	323	1.000	1.000	TMM59_HUMAN Transmembrane protein 59 OS=Homo sapiens OX=9606 GN=TMEM59 PE=1 SV=1
2	Q9QY73	0.0	604	323	0.941	0.941	TMM59_MOUSE Transmembrane protein 59 OS=Mus musculus OX=10090 GN=Tmem59 PE=1 SV=2
3	A8WG81	2.16e-73	231	339	0.415	0.395	A8WG81_DANRE Transmembrane protein 59-like OS=Danio rerio OX=7955 GN=wu:fi68e12 PE=2 SV=1
4	Q9UK28	1.32e-41	149	342	0.310	0.292	TM59L_HUMAN Transmembrane protein 59-like OS=Homo sapiens OX=9606 GN=TMEM59L PE=2 SV=1
5	Q7TNI2	8.28e-41	147	337	0.297	0.285	TM59L_MOUSE Transmembrane protein 59-like OS=Mus musculus OX=10090 GN=Tmem59l PE=2 SV=1
6	P0A8K1	1.6	32.7	322	0.111	0.112	PSD_ECOLI Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12) OX=83333 GN=psd PE=1 SV=1
7	Q9JIL8	2.2	32.7	1312	0.087	0.021	RAD50_RAT DNA repair protein RAD50 OS=Rattus norvegicus OX=10116 GN=Rad50 PE=1 SV=1
8	P31644	6.7	30.8	462	0.056	0.039	GBRA5_HUMAN Gamma-aminobutyric acid receptor subunit alpha-5 OS=Homo sapiens OX=9606 GN=GABRA5 PE=1 SV=1
9	P19969	6.8	30.8	464	0.056	0.039	GBRA5_RAT Gamma-aminobutyric acid receptor subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Gabra5 PE=2 SV=1
10	Q8BHJ7	7.7	30.8	463	0.056	0.039	GBRA5_MOUSE Gamma-aminobutyric acid receptor subunit alpha-5 OS=Mus musculus OX=10090 GN=Gabra5 PE=1 SV=1
11	A5JTM6	7.8	30.8	528	0.037	0.023	CBACL_PSEUC 4-chlorobenzoate--CoA ligase OS=Pseudomonas sp. (strain CBS-3) OX=72586 PE=1 SV=1
12	Q8QZS3	9.0	30.4	579	0.068	0.038	FLCN_MOUSE Folliculin OS=Mus musculus OX=10090 GN=Flcn PE=1 SV=1
13	Q92878	9.0	30.8	1312	0.087	0.021	RAD50_HUMAN DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12280 BSMAP	6.6e-68	240.3	Brain specific membrane anchored protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234831

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375872	0.979	Autophagy-related protein 16-1
2	9606.ENSP00000355991	0.783	TRAF3-interacting JNK-activating modulator
3	9606.ENSP00000432412	0.712	Autophagy-related protein 13
4	9606.ENSP00000338990	0.702	Autophagy-related protein 101
5	9606.ENSP00000470082	0.658	DNA-binding death effector domain-containing protein 2
6	9606.ENSP00000305675	0.645	Caveolae-associated protein 2
7	9606.ENSP00000233712	0.636	Protein eva-1 homolog A
8	9606.ENSP00000271064	0.628	Tubulointerstitial nephritis antigen-like
9	9606.ENSP00000364324	0.544	Constitutive coactivator of PPAR-gamma-like protein 2
10	9606.ENSP00000358072	0.532	Autophagy protein 5
11	9606.ENSP00000303992	0.524	Transmembrane protein 43
12	9606.ENSP00000483491	0.515	Mitochondrial inner membrane protein OXA1L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.742	catalytic activity
GO:0016787	0.727	hydrolase activity
GO:0008233	0.637	peptidase activity
GO:0004175	0.508	endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0044237	0.989	cellular metabolic process
GO:0044238	0.987	primary metabolic process
GO:0050794	0.986	regulation of cellular process
GO:1901564	0.986	organonitrogen compound metabolic process
GO:0019538	0.982	protein metabolic process
GO:0036211	0.972	protein modification process
GO:0009059	0.934	macromolecule biosynthetic process
GO:0044249	0.927	cellular biosynthetic process
GO:0044260	0.923	cellular macromolecule metabolic process
GO:0019222	0.904	regulation of metabolic process
GO:0034645	0.897	cellular macromolecule biosynthetic process
GO:0032879	0.896	regulation of localization
GO:0070085	0.885	glycosylation
GO:1904375	0.882	regulation of protein localization to cell periphery
GO:0048518	0.877	positive regulation of biological process
GO:0009100	0.873	glycoprotein metabolic process
GO:1901137	0.853	carbohydrate derivative biosynthetic process
GO:1901566	0.847	organonitrogen compound biosynthetic process
GO:0031323	0.779	regulation of cellular metabolic process
GO:0048522	0.762	positive regulation of cellular process
GO:0009101	0.724	glycoprotein biosynthetic process
GO:1905475	0.715	regulation of protein localization to membrane
GO:0006486	0.669	protein glycosylation
GO:0048519	0.636	negative regulation of biological process
GO:1903076	0.516	regulation of protein localization to plasma membrane
GO:0009894	0.498	regulation of catabolic process
GO:0048523	0.424	negative regulation of cellular process
GO:0010506	0.354	regulation of autophagy
GO:0009893	0.338	positive regulation of metabolic process
GO:0031325	0.312	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005773	0.998	vacuole
GO:0005576	0.997	extracellular region
GO:0005768	0.995	endosome
GO:0031985	0.995	Golgi cisterna
GO:0070062	0.989	extracellular exosome
GO:0005764	0.988	lysosome
GO:0000138	0.982	Golgi trans cisterna
GO:0005797	0.980	Golgi medial cisterna
GO:0000137	0.980	Golgi cis cisterna
GO:0005770	0.979	late endosome
GO:0016020	0.949	membrane
GO:0070013	0.467	intracellular organelle lumen
GO:0031090	0.319	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.727	Hydrolases.
EC:3.4.-.-	0.637	Acting on peptide bonds (peptidases).

[back to server]