StarFunc result for job id Q9BXS6

User Input

>input (441 residues)
MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTS
ASSCDETEIQISNQEEAERQPLGHVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHE
KQESQDLRATAKVPSPPDEHQEAENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAI
TTPNFKKLHEAHFKEMESIDQYIERKKKHFEEHNSMNELKQQPINKGGVRTPVPPRGRLS
VASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKT
PARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDL
KASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQ
ERKEKKAKVLGMRRGLILAED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXS6	1.000	1.000	1.631E-62	441	1.000	1.000	Q9BXS6.pdb.gz	NUSAP_HUMAN Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1
2	AFDB:Q9ERH4	0.179	0.183	2.382E-35	427	0.617	0.637	Q9ERH4.pdb.gz	NUSAP_MOUSE Nucleolar and spindle-associated protein 1 OS=Mus musculus OX=10090 GN=Nusap1 PE=1 SV=1
3	AFDB:A1L2F3	0.161	0.159	2.339E-20	446	0.354	0.350	A1L2F3.pdb.gz	NUSAP_DANRE Nucleolar and spindle-associated protein 1 OS=Danio rerio OX=7955 GN=nusap1 PE=2 SV=2
4	AFDB:A1Z971	0.120	0.082	7.478E-3	700	0.166	0.104	A1Z971.pdb.gz	A1Z971_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=dRNF34 PE=1 SV=1
5	AFDB:P20240	0.099	0.102	1.334E-2	424	0.138	0.144	P20240.pdb.gz	OTE_DROME Otefin OS=Drosophila melanogaster OX=7227 GN=Ote PE=1 SV=2
6	AFDB:A0A499FIJ6	0.087	0.050	6.238E-2	1031	0.147	0.063	A0A499FIJ6.pdb.gz	A0A499FIJ6_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=2
7	AFDB:B0QY83	0.094	0.048	6.652E-2	981	0.161	0.072	B0QY83.pdb.gz	B0QY83_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=3
8	AFDB:A0A2R8RUQ1	0.073	0.044	9.783E-2	828	0.145	0.077	A0A2R8RUQ1.pdb.gz
9	AFDB:A0A0G2JXC5	0.076	0.040	1.636E-1	1038	0.143	0.061	A0A0G2JXC5.pdb.gz	A0A0G2JXC5_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
10	AFDB:Q15424	0.088	0.049	1.636E-1	915	0.122	0.059	Q15424.pdb.gz	SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4
11	PDB:1zbuB	0.083	0.120	1.039	304	0.018	0.026	1zbuB.pdb.gz	Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
12	PDB:1ihfB	0.070	0.271	1.260	94	0.018	0.085	1ihfB.pdb.gz	Crystal structure of an IHF-DNA complex: a protein-induced DNA U-turn.
13	PDB:3s5wB	0.043	0.046	3.524	414	0.014	0.014	3s5wB.pdb.gz	Two Structures of an N-Hydroxylating Flavoprotein Monooxygenase: ORNITHINE HYDROXYLASE FROM PSEUDOMONAS AERUGINOSA.
14	PDB:1kcfA	0.056	0.103	3.758	240	0.023	0.042	1kcfA.pdb.gz
15	PDB:4v6wCh	0.053	0.163	4.558	123	0.032	0.114	4v6wCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
16	PDB:2f6lA	0.073	0.166	4.860	166	0.016	0.042	2f6lA.pdb.gz
17	PDB:5apnh	0.072	0.223	5.183	119	0.029	0.109	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:3jcmB	0.088	0.091	5.527	429	0.020	0.021	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
19	PDB:5nx4A	0.053	0.073	7.147	293	0.018	0.027	5nx4A.pdb.gz
20	PDB:6jcxF	0.072	0.142	7.147	186	0.018	0.043	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXS6	0.0	906	441	1.000	1.000	NUSAP_HUMAN Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1
2	Q9ERH4	8.85e-157	452	427	0.587	0.607	NUSAP_MOUSE Nucleolar and spindle-associated protein 1 OS=Mus musculus OX=10090 GN=Nusap1 PE=1 SV=1
3	A1L2F3	6.28e-66	219	446	0.392	0.388	NUSAP_DANRE Nucleolar and spindle-associated protein 1 OS=Danio rerio OX=7955 GN=nusap1 PE=2 SV=2
4	Q9VC08	0.090	37.7	754	0.045	0.027	Q9VC08_DROME LD43724p OS=Drosophila melanogaster OX=7227 GN=Mink PE=1 SV=2
5	F4HWS2	4.6	32.3	4146	0.045	0.005	F4HWS2_ARATH Calcium-dependent lipid-binding family protein OS=Arabidopsis thaliana OX=3702 GN=At1g48090 PE=1 SV=1
6	A8K031	6.3	31.6	642	0.054	0.037	A8K031_HUMAN Kinetochore protein NDC80 OS=Homo sapiens OX=9606 GN=KNTC2 PE=2 SV=1
7	O14777	6.3	31.6	642	0.054	0.037	NDC80_HUMAN Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16006 NUSAP	5.8e-112	385.9	Nucleolar and spindle-associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000453403

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378699	0.995	Cyclin-dependent kinase 1
2	9606.ENSP00000260731	0.993	Kinesin-like protein KIF11
3	9606.ENSP00000247191	0.992	Disks large-associated protein 5
4	9606.ENSP00000356379	0.991	Abnormal spindle-like microcephaly-associated protein
5	9606.ENSP00000361540	0.991	Cell division cycle protein 20 homolog
6	9606.ENSP00000251496	0.990	Condensin complex subunit 3
7	9606.ENSP00000274026	0.989	Cyclin-A2
8	9606.ENSP00000411532	0.987	DNA topoisomerase 2-alpha
9	9606.ENSP00000360540	0.983	Centrosomal protein of 55 kDa
10	9606.ENSP00000362146	0.983	Borealin
11	9606.ENSP00000261597	0.982	Kinetochore protein NDC80 homolog
12	9606.ENSP00000377793	0.982	Protein regulator of cytokinesis 1
13	9606.ENSP00000288207	0.980	G2/mitotic-specific cyclin-B2
14	9606.ENSP00000357643	0.980	Proliferation marker protein Ki-67
15	9606.ENSP00000296509	0.978	Mitotic spindle assembly checkpoint protein MAD2A
16	9606.ENSP00000355922	0.977	Centromere protein F
17	9606.ENSP00000378356	0.977	Kinesin-like protein KIF20A
18	9606.ENSP00000260363	0.976	Kinesin-like protein KIF23
19	9606.ENSP00000300093	0.975	Serine/threonine-protein kinase PLK1
20	9606.ENSP00000348838	0.975	Ubiquitin-conjugating enzyme E2 C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0008017	0.998	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0016043	0.993	cellular component organization
GO:1902850	0.980	microtubule cytoskeleton organization involved in mitosis
GO:0007346	0.972	regulation of mitotic cell cycle
GO:0098813	0.971	nuclear chromosome segregation
GO:0048522	0.968	positive regulation of cellular process
GO:0033043	0.967	regulation of organelle organization
GO:0010564	0.966	regulation of cell cycle process
GO:0000070	0.957	mitotic sister chromatid segregation
GO:0051179	0.956	localization
GO:0045787	0.952	positive regulation of cell cycle
GO:0051640	0.932	organelle localization
GO:0051234	0.926	establishment of localization
GO:0090068	0.922	positive regulation of cell cycle process
GO:0051656	0.892	establishment of organelle localization
GO:0051783	0.878	regulation of nuclear division
GO:0051653	0.819	spindle localization
GO:0051130	0.814	positive regulation of cellular component organization
GO:0010638	0.789	positive regulation of organelle organization
GO:0051641	0.747	cellular localization
GO:0051649	0.582	establishment of localization in cell
GO:0030261	0.554	chromosome condensation
GO:0007088	0.530	regulation of mitotic nuclear division
GO:0051301	0.493	cell division
GO:0051785	0.493	positive regulation of nuclear division
GO:0061640	0.479	cytoskeleton-dependent cytokinesis
GO:0040001	0.456	establishment of mitotic spindle localization
GO:0000281	0.379	mitotic cytokinesis
GO:0019222	0.348	regulation of metabolic process
GO:0060255	0.339	regulation of macromolecule metabolic process
GO:0051171	0.336	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	0.999	nucleolus
GO:0072686	0.998	mitotic spindle
GO:0005737	0.957	cytoplasm
GO:0005654	0.956	nucleoplasm
GO:0005829	0.947	cytosol
GO:0005815	0.518	microtubule organizing center
GO:0005813	0.495	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]