StarFunc result for job id Q9BXS9

User Input

>input (759 residues)
MGLADASGPRDTQALLSATQAMDLRRRDYHMERPLLNQEHLEELGRWGSAPRTHQWRTWL
QCSRARAYALLLQHLPVLVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQALNDSMINETARDAAR
VQVASTLSVLVGLFQVGLGLIHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLS
SHSGPLSLIYTVLEVCWKLPQSKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPMPIPGELL
TLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAI
SLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGA
ISSLFILLIIVKLGELFHDLPKAVLAAIIIVNLKGMLRQLSDMRSLWKANRADLLIWLVT
FTATILLNLDLGLVVAVIFSLLLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGV
KVFRSSATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQ
AASPKGASVSINVNTSLEDMRSNNVEDCKMMQVSSGDKMEDATANGQEDSKAPDGSTLKA
LGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGH
FFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXS9	1.000	1.000	0.000	759	1.000	1.000	Q9BXS9.pdb.gz	S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo sapiens OX=9606 GN=SLC26A6 PE=1 SV=1
2	AFDB:D3Z9I5	0.907	0.908	2.210E-89	758	0.769	0.770	D3Z9I5.pdb.gz	D3Z9I5_RAT Solute carrier family 26 member 6 OS=Rattus norvegicus OX=10116 GN=Slc26a6 PE=1 SV=1
3	AFDB:A9JTH4	0.833	0.783	1.389E-66	808	0.473	0.444	A9JTH4.pdb.gz	A9JTH4_DANRE Solute carrier family 26 member 6, like OS=Danio rerio OX=7955 GN=SLC26A6 PE=2 SV=1
4	AFDB:A9C3T3	0.829	0.842	3.495E-66	747	0.478	0.486	A9C3T3.pdb.gz	A9C3T3_DANRE Solute carrier family 26 member 6 OS=Danio rerio OX=7955 GN=slc26a6 PE=3 SV=2
5	AFDB:A0A2R8RSH7	0.816	0.860	5.857E-63	719	0.468	0.494	A0A2R8RSH7.pdb.gz
6	AFDB:Q7T2C4	0.818	0.840	1.410E-62	739	0.411	0.422	Q7T2C4.pdb.gz	S26A5_DANRE Prestin OS=Danio rerio OX=7955 GN=slc26a5 PE=2 SV=1
7	AFDB:A0A0A7HG43	0.842	0.817	1.918E-62	783	0.435	0.421	A0A0A7HG43.pdb.gz	A0A0A7HG43_ONCMY Slc26a6 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
8	AFDB:Q9R154	0.824	0.802	1.421E-60	780	0.386	0.376	Q9R154.pdb.gz	S26A4_RAT Pendrin OS=Rattus norvegicus OX=10116 GN=Slc26a4 PE=1 SV=1
9	AFDB:P58743	0.822	0.838	1.849E-60	744	0.393	0.401	P58743.pdb.gz	S26A5_HUMAN Prestin OS=Homo sapiens OX=9606 GN=SLC26A5 PE=1 SV=1
10	AFDB:C8XTB7	0.848	0.847	8.667E-58	760	0.365	0.364	C8XTB7.pdb.gz	C8XTB7_DANRE Pendrin OS=Danio rerio OX=7955 GN=si:dkey-31f5.9 PE=2 SV=1
11	PDB:7lguA	0.751	0.831	3.139E-54	680	0.381	0.425	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
12	PDB:7ch1A	0.773	0.912	4.889E-47	640	0.320	0.380	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
13	PDB:4yzfA	0.374	0.553	4.550E-7	475	0.082	0.131	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
14	PDB:3qe7A	0.362	0.619	1.003E-6	407	0.084	0.157	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
15	PDB:5i6cA	0.414	0.624	1.250E-6	480	0.094	0.148	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
16	PDB:8cs9g	0.376	0.348	5.565E-6	832	0.100	0.091	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
17	PDB:7tvzA	0.376	0.341	5.966E-5	850	0.104	0.093	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
18	PDB:6caaA	0.342	0.499	7.966E-4	477	0.086	0.136	6caaA.pdb.gz
19	PDB:2wsxA	0.129	0.173	2.148E-2	496	0.101	0.155	2wsxA.pdb.gz	Structural Basis of Na(+)-Independent and Cooperative Substrate/Product Antiport in Cait.
20	PDB:6jhkA	0.098	0.599	3.334E-2	116	0.012	0.078	6jhkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A7HG43	0.0	625	783	0.436	0.423	A0A0A7HG43_ONCMY Slc26a6 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
2	A0A8I6AS58	0.0	1090	704	0.734	0.791	A0A8I6AS58_RAT Solute carrier family 26 member 6 OS=Rattus norvegicus OX=10116 GN=Slc26a6 PE=1 SV=1
3	A9C3T3	0.0	710	747	0.477	0.485	A9C3T3_DANRE Solute carrier family 26 member 6 OS=Danio rerio OX=7955 GN=slc26a6 PE=3 SV=2
4	A9JTH4	0.0	694	808	0.482	0.453	A9JTH4_DANRE Solute carrier family 26 member 6, like OS=Danio rerio OX=7955 GN=SLC26A6 PE=2 SV=1
5	D3Z9I5	0.0	1161	758	0.776	0.777	D3Z9I5_RAT Solute carrier family 26 member 6 OS=Rattus norvegicus OX=10116 GN=Slc26a6 PE=1 SV=1
6	O43511	0.0	541	780	0.387	0.377	S26A4_HUMAN Pendrin OS=Homo sapiens OX=9606 GN=SLC26A4 PE=1 SV=1
7	P58743	0.0	578	744	0.395	0.403	S26A5_HUMAN Prestin OS=Homo sapiens OX=9606 GN=SLC26A5 PE=1 SV=1
8	Q7T2C4	0.0	602	739	0.418	0.429	S26A5_DANRE Prestin OS=Danio rerio OX=7955 GN=slc26a5 PE=2 SV=1
9	Q8CIW6	0.0	1171	758	0.784	0.785	S26A6_MOUSE Solute carrier family 26 member 6 OS=Mus musculus OX=10090 GN=Slc26a6 PE=1 SV=2
10	Q99NH7	0.0	581	744	0.393	0.401	S26A5_MOUSE Prestin OS=Mus musculus OX=10090 GN=Slc26a5 PE=1 SV=3
11	Q9BXS9	0.0	1546	759	1.000	1.000	S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo sapiens OX=9606 GN=SLC26A6 PE=1 SV=1
12	Q9EPH0	0.0	581	744	0.393	0.401	S26A5_RAT Prestin OS=Rattus norvegicus OX=10116 GN=Slc26a5 PE=1 SV=1
13	C8XTB7	8.00e-180	535	760	0.377	0.376	C8XTB7_DANRE Pendrin OS=Danio rerio OX=7955 GN=si:dkey-31f5.9 PE=2 SV=1
14	Q9R155	9.98e-179	533	780	0.382	0.372	S26A4_MOUSE Pendrin OS=Mus musculus OX=10090 GN=Slc26a4 PE=1 SV=1
15	Q9R154	4.37e-178	531	780	0.382	0.372	S26A4_RAT Pendrin OS=Rattus norvegicus OX=10116 GN=Slc26a4 PE=1 SV=1
16	B6DUH7	8.64e-176	524	745	0.365	0.372	B6DUH7_DANRE Chloride anion exchanger OS=Danio rerio OX=7955 GN=si:dkey-31f5.2 PE=2 SV=1
17	P40879	6.37e-170	509	764	0.362	0.360	S26A3_HUMAN Chloride anion exchanger OS=Homo sapiens OX=9606 GN=SLC26A3 PE=1 SV=1
18	Q7LBE3	3.13e-167	503	791	0.353	0.339	S26A9_HUMAN Solute carrier family 26 member 9 OS=Homo sapiens OX=9606 GN=SLC26A9 PE=1 SV=1
19	Q8BU91	1.64e-166	501	790	0.354	0.341	S26A9_MOUSE Solute carrier family 26 member 9 OS=Mus musculus OX=10090 GN=Slc26a9 PE=1 SV=1
20	Q924C9	1.01e-164	496	757	0.370	0.371	S26A3_RAT Chloride anion exchanger OS=Rattus norvegicus OX=10116 GN=Slc26a3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16983 MFS_MOT1	8.2	18.3	Molybdate transporter of MFS superfamily
2	PF01740 STAS	3.6e-18	76.7	STAS domain
3	PF00916 Sulfate_transp	3.8e-107	370.0	Sulfate permease family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378920

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000003084	0.993	Cystic fibrosis transmembrane conductance regulator
2	9606.ENSP00000285379	0.893	Carbonic anhydrase 2
3	9606.ENSP00000393557	0.817	Electrogenic sodium bicarbonate cotransporter 1
4	9606.ENSP00000273063	0.776	Anion exchange protein 3
5	9606.ENSP00000262613	0.766	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
6	9606.ENSP00000264938	0.751	Sodium/hydrogen exchanger 3
7	9606.ENSP00000392411	0.750	Solute carrier family 13 member 2
8	9606.ENSP00000347454	0.728	Anoctamin-1
9	9606.ENSP00000408005	0.722	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
10	9606.ENSP00000394485	0.719	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
11	9606.ENSP00000442397	0.713	Sodium-dependent phosphate transport protein 2C
12	9606.ENSP00000332413	0.699	Bestrophin-3
13	9606.ENSP00000419412	0.689	Anion exchange protein 2
14	9606.ENSP00000358814	0.672	S-adenosylhomocysteine hydrolase-like protein 1
15	9606.ENSP00000359478	0.666	Canalicular multispecific organic anion transporter 1
16	9606.ENSP00000366084	0.662	Multidrug resistance-associated protein 4
17	9606.ENSP00000295736	0.657	Sodium bicarbonate cotransporter 3
18	9606.ENSP00000262461	0.655	Solute carrier family 12 member 2
19	9606.ENSP00000265593	0.651	Chloride channel protein 2
20	9606.ENSP00000339867	0.648	Chloride channel protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015106	0.997	bicarbonate transmembrane transporter activity
GO:0015116	0.997	sulfate transmembrane transporter activity
GO:0015108	0.997	chloride transmembrane transporter activity
GO:0005452	0.997	solute:inorganic anion antiporter activity
GO:0005515	0.995	protein binding
GO:0046873	0.757	metal ion transmembrane transporter activity
GO:0022853	0.708	active monoatomic ion transmembrane transporter activity
GO:0005342	0.520	organic acid transmembrane transporter activity
GO:0046943	0.504	carboxylic acid transmembrane transporter activity
GO:0015081	0.485	sodium ion transmembrane transporter activity
GO:0022803	0.435	passive transmembrane transporter activity
GO:0015267	0.423	channel activity
GO:0005216	0.405	monoatomic ion channel activity
GO:0005310	0.384	dicarboxylic acid transmembrane transporter activity
GO:0005254	0.363	chloride channel activity
GO:0015370	0.333	solute:sodium symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.997	transport
GO:0015698	0.974	inorganic anion transport
GO:0006811	0.969	monoatomic ion transport
GO:0072348	0.964	sulfur compound transport
GO:0015711	0.962	organic anion transport
GO:0006820	0.955	monoatomic anion transport
GO:0065007	0.895	biological regulation
GO:0006821	0.887	chloride transport
GO:0009987	0.877	cellular process
GO:0046942	0.646	carboxylic acid transport
GO:0050896	0.412	response to stimulus
GO:0050789	0.409	regulation of biological process
GO:0050794	0.362	regulation of cellular process
GO:0055085	0.326	transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0045177	0.997	apical part of cell
GO:0016324	0.993	apical plasma membrane
GO:0005903	0.677	brush border
GO:0031526	0.670	brush border membrane
GO:0043227	0.541	membrane-bounded organelle
GO:0031982	0.394	vesicle
GO:0009925	0.332	basal plasma membrane
GO:0005622	0.324	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28695	0.997	hydrogencarbonate(in) = hydrogencarbonate(out)
RHEA:34983	0.997	sulfate(in) = sulfate(out)
RHEA:29823	0.997	chloride(in) = chloride(out)
RHEA:34963	0.485	Na(+)(in) = Na(+)(out)

[back to server]