StarFunc result for job id Q9BXT4

User Input

>input (1180 residues)
MSVKSPFNVMSRNNLEAPPCKMTEPFNFEKNENKLPPHESLRSPGTLPNHPNFRLKSSEN
GNKKNNFLLCEQTKQYLASQEDNSVSSNPNGINGEVVGSKGDRKKLPAGNSVSPPSAESN
SPPKEVNIKPGNNVRPAKSKKLNKLVENSLSISNPGLFTSLGPPLRSTTCHRCGLFGSLR
CSQCKQTYYCSTACQRRDWSAHSIVCRPVQPNFHKLENKSSIETKDVEVNNKSDCPLGVT
KEIAIWAERIMFSDLRSLQLKKTMEIKGTVTEFKHPGDFYVQLYSSEVLEYMNQLSASLK
ETYANVHEKDYIPVKGEVCIAKYTVDQTWNRAIIQNVDVQQKKAHVLYIDYGNEEIIPLN
RIYHLNRNIDLFPPCAIKCFVANVIPAEGNWSSDCIKATKPLLMEQYCSIKIVDILEEEV
VTFAVEVELPNSGKLLDHVLIEMGYGLKPSGQDSKKENADQSDPEDVGKMTTENNIVVDK
SDLIPKVLTLNVGDEFCGVVAHIQTPEDFFCQQLQSGRKLAELQASLSKYCDQLPPRSDF
YPAIGDICCAQFSEDDQWYRASVLAYASEESVLVGYVDYGNFEILSLMRLCPIIPKLLEL
PMQAIKCVLAGVKPSLGIWTPEAICLMKKLVQNKIITVKVVDKLENSSLVELIDKSETPH
VSVSKVLLDAGFAVGEQSMVTDKPSDVKETSVPLGVEGKVNPLEWTWVELGVDQTVDVVV
CVIYSPGEFYCHVLKEDALKKLNDLNKSLAEHCQQKLPNGFKAEIGQPCCAFFAGDGSWY
RALVKEILPNGHVKVHFVDYGNIEEVTADELRMISSTFLNLPFQGIRCQLADIQSRNKHW
SEEAITRFQMCVAGIKLQARVVEVTENGIGVELTDLSTCYPRIISDVLIDEHLVLKSASP
HKDLPNDRLVNKHELQVHVQGLQATSSAEQWKTIELPVDKTIQANVLEIISPNLFYALPK
GMPENQEKLCMLTAELLEYCNAPKSRPPYRPRIGDACCAKYTSDDFWYRAVVLGTSDTDV
EVLYADYGNIETLPLCRVQPITSSHLALPFQIIRCSLEGLMELNGSSSQLIIMLLKNFML
NQNVMLSVKGITKNVHTVSVEKCSENGTVDVADKLVTFGLAKNITPQRQSALNTEKMYRM
NCCCTELQKQVEKHEHILLFLLNNSTNQNKFIEMKKLLKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXT4	1.000	1.000	0.000	1180	1.000	1.000	Q9BXT4.pdb.gz	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
2	AFDB:Q90WE3	0.191	0.128	4.221E-50	1905	0.153	0.094	Q90WE3.pdb.gz	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
3	AFDB:F4JW79	0.066	0.059	9.427E-6	1493	0.097	0.076	F4JW79.pdb.gz	RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana OX=3702 GN=RDM3 PE=1 SV=1
4	AFDB:A0A494C1M0	0.061	0.069	1.138E-4	1011	0.108	0.126	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
5	AFDB:O15117	0.051	0.065	2.428E-4	783	0.080	0.120	O15117.pdb.gz	FYB1_HUMAN FYN-binding protein 1 OS=Homo sapiens OX=9606 GN=FYB1 PE=1 SV=2
6	AFDB:O35413	0.047	0.047	2.856E-4	1196	0.068	0.067	O35413.pdb.gz	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
7	PDB:7okyZ	0.048	0.125	3.297E-4	374	0.042	0.134	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
8	AFDB:Q04164	0.052	0.041	4.650E-4	1693	0.092	0.064	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
9	AFDB:Q3LHL9	0.049	0.041	1.106E-3	1658	0.105	0.075	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
10	AFDB:Q9BX66	0.048	0.045	1.450E-3	1292	0.122	0.111	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
11	PDB:6tedZ	0.051	0.098	1.766E-3	510	0.039	0.090	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
12	PDB:2hyeA	0.068	0.069	3.035E-3	1140	0.064	0.066	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
13	PDB:6r8yK	0.061	0.072	3.204E-3	825	0.058	0.084	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
14	PDB:7abi7	0.048	0.223	3.204E-3	236	0.022	0.110	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
15	PDB:7lpsA	0.058	0.071	3.204E-3	781	0.066	0.100	7lpsA.pdb.gz	Acute pharmacological degradation of Helios destabilizes regulatory T cells.
16	AFDB:D3ZIE4	0.060	0.079	6.254E-3	830	0.070	0.100	D3ZIE4.pdb.gz	FYB1_RAT FYN-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Fyb1 PE=1 SV=2
17	PDB:3mp8A	0.047	0.102	8.044E-3	513	0.021	0.049	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
18	PDB:5nrlP	0.057	0.056	2.019E-2	1186	0.085	0.084	5nrlP.pdb.gz	Structure of a pre-catalytic spliceosome.
19	PDB:4ifdH	0.037	0.124	4.309E-2	295	0.014	0.058	4ifdH.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
20	PDB:1griA	0.040	0.192	4.802E-2	211	0.028	0.156	1griA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9CPT4	0.0	580	1133	0.291	0.303	TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes OX=8090 GN=tdrd1 PE=2 SV=1
2	Q58EK5	0.0	605	1175	0.298	0.300	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
3	Q99MV1	0.0	1731	1172	0.715	0.720	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
4	Q9BXT4	0.0	2439	1180	1.000	1.000	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
5	F1R237	1.39e-49	195	2117	0.192	0.107	TDRD6_DANRE Tudor domain-containing 6 OS=Danio rerio OX=7955 GN=tdrd6 PE=1 SV=2
6	P61407	1.24e-27	124	2134	0.140	0.077	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
7	Q90WE3	3.24e-27	122	1905	0.122	0.076	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
8	Q8MTA5	1.45e-26	120	1527	0.129	0.100	Q8MTA5_DROME AT14886p OS=Drosophila melanogaster OX=7227 GN=qin PE=2 SV=1
9	Q9VE55	2.54e-26	120	1857	0.126	0.080	Q9VE55_DROME Qin OS=Drosophila melanogaster OX=7227 GN=qin PE=1 SV=4
10	A6NAF9	4.09e-23	109	1079	0.081	0.089	TRD7A_DANRE Tudor domain-containing protein 7A OS=Danio rerio OX=7955 GN=tdrd7a PE=2 SV=2
11	Q99MV7	1.71e-22	107	1640	0.135	0.097	RNF17_MOUSE RING finger protein 17 OS=Mus musculus OX=10090 GN=Rnf17 PE=1 SV=2
12	Q8K1H1	1.02e-20	101	1086	0.125	0.135	TDRD7_MOUSE Tudor domain-containing protein 7 OS=Mus musculus OX=10090 GN=Tdrd7 PE=1 SV=1
13	Q8NHU6	1.63e-20	100	1098	0.134	0.144	TDRD7_HUMAN Tudor domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TDRD7 PE=1 SV=2
14	Q9R1R4	2.18e-20	100	1113	0.129	0.137	TDRD7_RAT Tudor domain-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Tdrd7 PE=1 SV=1
15	E1C3S7	4.66e-20	99.4	1071	0.103	0.113	TDRD7_CHICK Tudor domain-containing protein 7 OS=Gallus gallus OX=9031 GN=TDRD7 PE=2 SV=1
16	Q9Y2W6	4.44e-19	94.7	561	0.042	0.089	TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH PE=1 SV=2
17	Q80VL1	1.14e-16	87.4	560	0.043	0.091	TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus OX=10090 GN=Tdrkh PE=1 SV=1
18	Q5VCS6	9.22e-15	82.0	1040	0.044	0.050	TDRD5_MOUSE Tudor domain-containing protein 5 OS=Mus musculus OX=10090 GN=Tdrd5 PE=1 SV=3
19	P25823	2.00e-12	74.7	2515	0.164	0.077	TUD_DROME Maternal protein tudor OS=Drosophila melanogaster OX=7227 GN=tud PE=1 SV=2
20	H9JD76	9.63e-12	71.6	629	0.047	0.089	TDRKH_BOMMO Tudor and KH domain-containing protein homolog OS=Bombyx mori OX=7091 GN=PAPI PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05641 Agenet	0.38	22.6	Agenet domain
2	PF15057 DUF4537	0.037	25.4	Domain of unknown function (DUF4537)
3	PF06003 SMN	1e-10	52.9	Survival motor neuron protein (SMN)
4	PF05036 SPOR	12	17.6	SPOR domain
5	PF00567 TUDOR	3.2e-128	432.5	Tudor domain
6	PF01753 zf-MYND	2.2e-06	39.0	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251864

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349208	0.999	Piwi-like protein 2
2	9606.ENSP00000245255	0.986	Piwi-like protein 1
3	9606.ENSP00000299001	0.986	Piwi-like protein 4
4	9606.ENSP00000390621	0.979	Putative ATP-dependent RNA helicase TDRD12
5	9606.ENSP00000359049	0.968	Small RNA 2'-O-methyltransferase
6	9606.ENSP00000252037	0.967	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
7	9606.ENSP00000424838	0.963	Probable ATP-dependent RNA helicase DDX4
8	9606.ENSP00000262794	0.961	RNA helicase Mov10l1
9	9606.ENSP00000284629	0.961	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
10	9606.ENSP00000356846	0.938	Protein maelstrom homolog
11	9606.ENSP00000335153	0.925	Heat shock protein HSP 90-alpha
12	9606.ENSP00000387303	0.862	ATP-dependent RNA helicase TDRD9
13	9606.ENSP00000357812	0.840	Tudor and KH domain-containing protein
14	9606.ENSP00000345571	0.801	Transcription factor E2F1
15	9606.ENSP00000446485	0.752	Gametocyte-specific factor 1
16	9606.ENSP00000440190	0.677	Tudor domain-containing protein 3
17	9606.ENSP00000379898	0.668	ADP-ribosylation factor-like protein 4A
18	9606.ENSP00000415056	0.658	piRNA biogenesis protein EXD1
19	9606.ENSP00000358423	0.621	Ras-related GTP-binding protein D
20	9606.ENSP00000317177	0.620	Mitochondrial cardiolipin hydrolase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.379	heterocyclic compound binding
GO:0097159	0.379	organic cyclic compound binding
GO:0003676	0.368	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0010468	0.980	regulation of gene expression
GO:0032501	0.974	multicellular organismal process
GO:0032502	0.973	developmental process
GO:0006139	0.946	nucleobase-containing compound metabolic process
GO:0090304	0.938	nucleic acid metabolic process
GO:0003006	0.929	developmental process involved in reproduction
GO:0048519	0.916	negative regulation of biological process
GO:0030154	0.911	cell differentiation
GO:0007276	0.908	gamete generation
GO:0016070	0.862	RNA metabolic process
GO:0048856	0.772	anatomical structure development
GO:0006396	0.710	RNA processing
GO:0009892	0.690	negative regulation of metabolic process
GO:0048468	0.677	cell development
GO:0022412	0.643	cellular process involved in reproduction in multicellular organism
GO:0010605	0.626	negative regulation of macromolecule metabolic process
GO:0032259	0.576	methylation
GO:0007283	0.568	spermatogenesis
GO:0031047	0.553	RNA-mediated gene silencing
GO:0070918	0.532	regulatory ncRNA processing
GO:0007281	0.505	germ cell development
GO:0050794	0.424	regulation of cellular process
GO:0044260	0.369	cellular macromolecule metabolic process
GO:0006259	0.354	DNA metabolic process
GO:0043412	0.328	macromolecule modification
GO:0006304	0.322	DNA modification
GO:0043414	0.320	macromolecule methylation
GO:0071840	0.310	cellular component organization or biogenesis
GO:0006306	0.308	DNA methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036464	0.999	cytoplasmic ribonucleoprotein granule
GO:0045495	0.998	pole plasm
GO:0005829	0.994	cytosol
GO:0043186	0.993	P granule
GO:0032991	0.992	protein-containing complex
GO:0033391	0.933	chromatoid body
GO:0070013	0.905	intracellular organelle lumen
GO:0043231	0.889	intracellular membrane-bounded organelle
GO:0005634	0.796	nucleus
GO:1990904	0.694	ribonucleoprotein complex
GO:0030054	0.517	cell junction
GO:0045202	0.413	synapse
GO:0012505	0.403	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]