StarFunc result for job id Q9BXT5

User Input

>input (1400 residues)
MPSDAKDSVNGDLLLNWTSLKNILSGLNASFPLHNNTGSSTVTTSKSIKDPRLMRREESM
GEQSSTAGLNEVLQFEKSSDNVNSEIKSTPSNSASSSEVVPGDCAVLTNGLDTPCFKTSV
NDSQSWAHNMGSEDYDCIPPNKVTMAGQCKDQGNFSFPISVSNVVSEVENQNHSEEKAQR
AQQESGNAYTKEYSSHIFQDSQSSDLKTIYQTGCQTSTVFPLKKKVSIDEYLQNTGKMKN
FADLEDSSKHEEKQTSWKEIDNDFTNETKISPIDNYIVLHQEYKESESHNSFGKSCDKIL
ITQELEITKSSTSTIKDKDELDHLALEWQITPSFESLSQKHPQHSVEYEGNIHTSLAIAQ
KLMELKLGKINQNYASIITEAFPKPKDIPQAKEMFIDTVISSYNIETAHDSSNCSITREH
ICVHRKNENEPVSLENIQRDYKETAYVEDRGQDHNLFCNSQLSNDIWLNVNFKKQTDREN
QNEAKENSASCVENNIENIYGDKKQDSHTNENFSNIDEKEDKNYHNIEILSSEEFSTKFN
LICREDNAVSAATALLESEEDTISAVKQKDTENTGRSVEHLASTTFPKTASSSVCVASNA
AIQIASATMPALSLNNDDHQIYQFKETCSSESPDFGLLVKHRVSDCEIDTDKNKSQESFH
QSINENLVLQSIELESEIEIELEDCDDAFIFQQDTHSHENMLCEEFVTSYKALKSRISWE
GLLALDNGEMEVLESTTGRENSDQHYSKESNYFYSSTQNNETELTSPILLPDLQIKITNI
FRPGFSPTADSLALKDSFCTHVTEATKPEINKEDGEILGFDIYSQPFGENADYPCEDKVD
NIRQESGPVSNSEISLSFDLSRNTDVNHTSENQNSESLFTEPSNVTTIDDGSRCFFTKSK
TDYNDTKNKKEVESRISKRKLHISSRDQNIPHKDLRRHKIYGRKRRLTSQDSSECFSSLS
QGRIKTFSQSEKHIKSVLNILSDEASLCKSKCLSRKLDKAVVHLKKAHRRVHTSLQLITK
VGEERKGPLPKSYAIICNNFWESCDLQGYSSVSQRKYYSTKHFSSKRKYDKRRKKRAPKA
DISKSLTHVSKHKSYKTSGEKKCLSRKSMASSVSKSHPTTSHMGEFCNQEHPESQLPVSS
TSQSTSQSVYYNSSVSNPSLSEEHQPFSGKTAYLFSPDHSDEKLIEKENQIDTAFLSSTS
KYEKLEKHSANHNVKDATKENSCDANEVINESNSVSLSCIKENINSSTGNDCDATCIGHT
KAKTDVLISVLDSNVKHFLNDLYQQGNLILSDCKRNLEVKWTDPIERPKQNIITGNFLMG
PLNLTLIASKKYSIPQLSAAAVTDSEGESSKSYLDKQRILTVDSFAASSTVPHCEQSCRE
KELLKTEQCSSGNCLHTDGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88466	0.039	0.034	3.059E-8	1888	0.146	0.109	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
2	AFDB:F4I096	0.047	0.038	6.579E-7	1921	0.164	0.119	F4I096.pdb.gz	MED13_ARATH Mediator of RNA polymerase II transcription subunit 13 OS=Arabidopsis thaliana OX=3702 GN=MED13 PE=1 SV=1
3	AFDB:Q9H2Y7	0.038	0.032	9.045E-6	1883	0.141	0.105	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
4	AFDB:Q8CGM2	0.047	0.039	1.168E-5	1859	0.134	0.101	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
5	AFDB:Q7KMH9	0.044	0.044	3.248E-5	1420	0.148	0.146	Q7KMH9.pdb.gz	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
6	AFDB:F4IZM8	0.048	0.049	4.195E-5	1347	0.116	0.121	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
7	AFDB:A8DZ29	0.032	0.031	5.417E-5	1919	0.139	0.102	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
8	AFDB:M9NFI9	0.039	0.027	8.474E-5	2148	0.152	0.099	M9NFI9.pdb.gz	M9NFI9_DROME Spinophilin, isoform J OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
9	AFDB:F4IN78	0.034	0.035	9.629E-5	1366	0.111	0.113	F4IN78.pdb.gz	HUAL2_ARATH Protein HUA2-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=HULK2 PE=2 SV=2
10	AFDB:Q3LHL9	0.038	0.034	1.094E-4	1658	0.146	0.124	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
11	PDB:3iqcA	0.034	0.354	3.378E-1	119	0.010	0.118	3iqcA.pdb.gz
12	PDB:6n63A	0.055	0.467	3.378E-1	141	0.011	0.106	6n63A.pdb.gz	Large protein organelles form a new iron sequestration system with high storage capacity.
13	PDB:4gwpC	0.039	0.225	6.005E-1	184	0.006	0.043	4gwpC.pdb.gz
14	PDB:7z37DP1	0.051	0.246	8.266E-1	273	0.012	0.062	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
15	PDB:2jmhA	0.043	0.325	8.812E-1	117	0.009	0.111	2jmhA.pdb.gz
16	PDB:4k34A	0.044	0.129	8.812E-1	381	0.005	0.018	4k34A.pdb.gz
17	PDB:1ni3A	0.048	0.164	1.001	378	0.009	0.034	1ni3A.pdb.gz
18	PDB:3favC	0.047	0.517	1.067	90	0.007	0.111	3favC.pdb.gz	WXG100 protein superfamily consists of three subfamilies and exhibits an alpha-helical C-terminal conserved residue pattern.
19	PDB:6r1mB	0.041	0.115	1.138	428	0.007	0.023	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
20	PDB:7u2aB	0.042	0.122	1.138	442	0.009	0.027	7u2aB.pdb.gz	Structural basis for shape-selective recognition and aminoacylation of a D-armless human mitochondrial tRNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VPN2	0.0	1001	2785	0.483	0.243	TEX15_MOUSE Testis-expressed protein 15 OS=Mus musculus OX=10090 GN=Tex15 PE=1 SV=1
2	O14470	1.4	35.8	503	0.014	0.038	SSR2_SCHPO SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssr2 PE=1 SV=3
3	Q93646	2.3	35.0	440	0.022	0.070	SNT1_CAEEL Syntrophin-1 OS=Caenorhabditis elegans OX=6239 GN=stn-1 PE=1 SV=1
4	Q9U4X0	3.6	34.7	2647	0.029	0.015	Q9U4X0_PLAFA Putative erythrocyte binding protein EBL-1 (Fragment) OS=Plasmodium falciparum OX=5833 GN=ebl-1 PE=4 SV=1
5	Q8VDD8	3.9	34.3	475	0.015	0.044	WASH1_MOUSE WASH complex subunit 1 OS=Mus musculus OX=10090 GN=Washc1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256246

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216024	0.931	Meiotic recombination protein DMC1/LIM15 homolog
2	9606.ENSP00000369497	0.925	Breast cancer type 2 susceptibility protein
3	9606.ENSP00000418960	0.922	Breast cancer type 1 susceptibility protein
4	9606.ENSP00000372088	0.915	DNA repair protein RAD51 homolog 1
5	9606.ENSP00000278616	0.913	Serine-protein kinase ATM
6	9606.ENSP00000479169	0.911	Histone H2B type 1-H
7	9606.ENSP00000334044	0.910	Ubiquitin-like protein 4B
8	9606.ENSP00000223129	0.907	Replication protein A 14 kDa subunit
9	9606.ENSP00000254719	0.902	Replication protein A 70 kDa DNA-binding subunit
10	9606.ENSP00000274764	0.902	Histone H2B type 1-A
11	9606.ENSP00000289316	0.902	Histone H2B type 1-D
12	9606.ENSP00000349430	0.902	Histone H2B type 1-K
13	9606.ENSP00000358151	0.902	Histone H2B type 2-E
14	9606.ENSP00000366618	0.902	Histone H2B type 1-L
15	9606.ENSP00000476136	0.902	Histone H2B type 1-J
16	9606.ENSP00000477527	0.902	Histone H2B type 1-O
17	9606.ENSP00000477907	0.902	Histone H2B type 1-M
18	9606.ENSP00000481622	0.902	Histone H2B type F-S
19	9606.ENSP00000482674	0.902	Histone H2B type 1-B
20	9606.ENSP00000483903	0.902	Histone H2B type 1-N

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.901	organic substance metabolic process
GO:0044237	0.900	cellular metabolic process
GO:0044238	0.897	primary metabolic process
GO:0006807	0.886	nitrogen compound metabolic process
GO:0043170	0.880	macromolecule metabolic process
GO:0065007	0.824	biological regulation
GO:0090304	0.823	nucleic acid metabolic process
GO:0050789	0.805	regulation of biological process
GO:0010468	0.791	regulation of gene expression
GO:0050794	0.593	regulation of cellular process
GO:0022414	0.561	reproductive process
GO:0071840	0.436	cellular component organization or biogenesis
GO:0006996	0.419	organelle organization
GO:0032501	0.400	multicellular organismal process
GO:0048518	0.394	positive regulation of biological process
GO:0048519	0.385	negative regulation of biological process
GO:0044260	0.384	cellular macromolecule metabolic process
GO:0048523	0.381	negative regulation of cellular process
GO:0006259	0.374	DNA metabolic process
GO:0022402	0.373	cell cycle process
GO:0048232	0.360	male gamete generation
GO:0032502	0.320	developmental process
GO:0022607	0.309	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.927	nuclear lumen
GO:0005737	0.825	cytoplasm
GO:0005654	0.724	nucleoplasm
GO:0005694	0.657	chromosome
GO:0032991	0.365	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]