StarFunc result for job id Q9BXT6

User Input

>input (1211 residues)
MLSLAAKLVAFFWRTADTPREEAGQLEPELAEGDTKLKTVRGVVTRYCSDYGMIDDMIYF
SSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL
IGCVTSLVEGAGCISQTTYFSLESVCEGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRY
KRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCYVWRAL
CMTLVKRRDAAPVHEATHFYGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDI
PQNLVSCKLAGWDKSKQFRFQMLDKDQMCPVVSFVSVPEKENSSDENINSLNSHTKNKTS
QMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVICDGK
NPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVV
TAQKRNSRRQLPSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWL
EEIYAEMELKEYNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGHAIEY
ISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEFTYNRTTSRRCHFALEHVIHLGVKVLFP
EEIILQSPQVTGNWNHAQDTKSSGQSTSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFT
AEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPYILFGPPGTGKTVTI
IEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDA
VKPYCRDGEDIWKASRFRIIITTCSSSGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPL
GLMSDISGQIVLAGDPMQLGPVIKSRLAMAYGLNVSFLERLMSRPAYQRDENAFGACGAH
NPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHG
VRGSEAREGKSPSWFNPAEAVQVLRYCCLLAHSISSQVSASDIGVITPYRKQVEKIRILL
RNVDLMDIKVGSVEEFQGQEYLVIIISTVRSNEDRFEDDRYFLGFLSNSKRFNVAITRPK
ALLIVLGNPHVLVRDPCFGALLEYSITNGVYMGCDLPPALQSLQNCGEGVADPSYPVVPE
STGPEKHQEPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99MV5	0.658	0.670	0.000	1187	0.770	0.786	Q99MV5.pdb.gz	M10L1_MOUSE RNA helicase Mov10l1 OS=Mus musculus OX=10090 GN=Mov10l1 PE=1 SV=1
2	AFDB:Q9BXT6	1.000	1.000	0.000	1211	1.000	1.000	Q9BXT6.pdb.gz	M10L1_HUMAN RNA helicase Mov10l1 OS=Homo sapiens OX=9606 GN=MOV10L1 PE=1 SV=1
3	AFDB:Q6J5K9	0.526	0.536	1.693E-88	1188	0.271	0.276	Q6J5K9.pdb.gz	ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster OX=7227 GN=armi PE=1 SV=4
4	AFDB:Q8GYD9	0.558	0.668	3.811E-75	1002	0.238	0.287	Q8GYD9.pdb.gz	SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana OX=3702 GN=SDE3 PE=1 SV=1
5	AFDB:D3ZUC2	0.543	0.650	3.243E-74	1004	0.252	0.304	D3ZUC2.pdb.gz	D3ZUC2_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Mov10 PE=3 SV=2
6	AFDB:A1Z9K0	0.472	0.430	1.375E-51	1333	0.167	0.152	A1Z9K0.pdb.gz	A1Z9K0_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=EP(2)2054 PE=1 SV=2
7	AFDB:Q6DFV5	0.409	0.263	2.532E-49	1964	0.185	0.114	Q6DFV5.pdb.gz	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
8	AFDB:P42694	0.418	0.271	3.928E-49	1942	0.178	0.111	P42694.pdb.gz	HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2
9	AFDB:A1ZAP7	0.453	0.705	6.134E-47	764	0.162	0.257	A1ZAP7.pdb.gz	A1ZAP7_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Mov10 PE=3 SV=2
10	AFDB:P30771	0.409	0.504	6.982E-41	971	0.149	0.185	P30771.pdb.gz	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1
11	PDB:5eanA	0.367	0.418	5.109E-33	1051	0.126	0.145	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
12	PDB:4pj3A	0.320	0.293	3.232E-22	1335	0.103	0.094	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
13	PDB:3jb9X	0.326	0.330	9.446E-13	1195	0.090	0.091	3jb9X.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	PDB:3k70D	0.204	0.407	1.180E-11	547	0.057	0.126	3k70D.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.
15	PDB:5ld2D	0.212	0.398	5.198E-11	605	0.056	0.112	5ld2D.pdb.gz	Mechanism for nuclease regulation in RecBCD.
16	PDB:2is4B	0.196	0.355	8.144E-8	632	0.053	0.101	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
17	PDB:3ex7C	0.185	0.499	1.014E-7	392	0.048	0.148	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
18	PDB:2eyqA	0.162	0.169	1.072E-7	1146	0.057	0.060	2eyqA.pdb.gz
19	PDB:6qw65B	0.196	0.127	1.264E-7	2001	0.075	0.045	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:7oo3b	0.176	0.347	3.394E-7	534	0.048	0.109	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99MV5	0.0	1011	1187	0.410	0.419	M10L1_MOUSE RNA helicase Mov10l1 OS=Mus musculus OX=10090 GN=Mov10l1 PE=1 SV=1
2	Q9BXT6	0.0	2509	1211	1.000	1.000	M10L1_HUMAN RNA helicase Mov10l1 OS=Homo sapiens OX=9606 GN=MOV10L1 PE=1 SV=1
3	Q5JR04	4.22e-130	424	947	0.247	0.316	Q5JR04_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=MOV10 PE=1 SV=1
4	Q9HCE1	1.41e-129	424	1003	0.247	0.298	MOV10_HUMAN Helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10 PE=1 SV=2
5	P23249	2.83e-119	396	1004	0.188	0.227	MOV10_MOUSE Putative helicase MOV-10 OS=Mus musculus OX=10090 GN=Mov10 PE=1 SV=2
6	Q6J5K9	3.72e-119	400	1188	0.219	0.223	ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster OX=7227 GN=armi PE=1 SV=4
7	D3ZUC2	4.81e-117	392	1074	0.185	0.209	D3ZUC2_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Mov10 PE=3 SV=2
8	Q8GYD9	9.40e-103	351	1002	0.173	0.209	SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana OX=3702 GN=SDE3 PE=1 SV=1
9	Q8WUE5	1.10e-67	231	264	0.106	0.485	CT55_HUMAN Cancer/testis antigen 55 OS=Homo sapiens OX=9606 GN=CT55 PE=1 SV=1
10	A1ZAP7	3.31e-66	241	764	0.133	0.211	A1ZAP7_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Mov10 PE=3 SV=2
11	Q8MQQ9	4.15e-64	241	1261	0.126	0.121	Q8MQQ9_DROME RNA helicase (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG6701 PE=2 SV=1
12	A1Z9K0	6.72e-64	240	1333	0.126	0.114	A1Z9K0_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=EP(2)2054 PE=1 SV=2
13	P42694	3.49e-47	187	1942	0.131	0.082	HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2
14	Q6DFV5	5.27e-47	187	1964	0.133	0.082	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
15	Q9VYS3	1.29e-41	169	1180	0.121	0.125	RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster OX=7227 GN=Upf1 PE=1 SV=2
16	P30771	4.00e-41	167	971	0.129	0.161	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1
17	Q9EPU0	4.04e-40	164	1124	0.122	0.132	RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus OX=10090 GN=Upf1 PE=1 SV=2
18	A0A024R7L5	5.22e-40	164	1118	0.121	0.131	A0A024R7L5_HUMAN UPF1 OS=Homo sapiens OX=9606 GN=UPF1 PE=2 SV=1
19	Q92900	6.76e-40	163	1129	0.121	0.130	RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2
20	F1RCY6	8.56e-40	163	1100	0.121	0.134	RENT1_DANRE Regulator of nonsense transcripts 1 OS=Danio rerio OX=7955 GN=upf1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	3.4e+02	13.1	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	2.7e-26	104.5	AAA domain
3	PF13087 AAA_12	2.4e-39	146.5	AAA domain
4	PF13245 AAA_19	0.026	26.2	AAA domain
5	PF13401 AAA_22	5e+02	12.4	AAA domain
6	PF13604 AAA_30	9.5e-08	43.5	AAA domain
7	PF04851 ResIII	36	15.8	Type III restriction enzyme, res subunit
8	PF14444 S1-like	4.7e-05	34.7	S1-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262794

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252037	0.980	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
2	9606.ENSP00000349208	0.980	Piwi-like protein 2
3	9606.ENSP00000359049	0.975	Small RNA 2'-O-methyltransferase
4	9606.ENSP00000284629	0.972	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
5	9606.ENSP00000387303	0.967	ATP-dependent RNA helicase TDRD9
6	9606.ENSP00000251864	0.961	Tudor domain-containing protein 1
7	9606.ENSP00000299001	0.955	Piwi-like protein 4
8	9606.ENSP00000356846	0.950	Protein maelstrom homolog
9	9606.ENSP00000245255	0.944	Piwi-like protein 1
10	9606.ENSP00000424838	0.930	Probable ATP-dependent RNA helicase DDX4
11	9606.ENSP00000390621	0.921	Putative ATP-dependent RNA helicase TDRD12
12	9606.ENSP00000335153	0.911	Heat shock protein HSP 90-alpha
13	9606.ENSP00000357812	0.894	Tudor and KH domain-containing protein
14	9606.ENSP00000317177	0.879	Mitochondrial cardiolipin hydrolase
15	9606.ENSP00000406052	0.864	Tudor domain-containing protein 5
16	9606.ENSP00000446485	0.744	Gametocyte-specific factor 1
17	9606.ENSP00000379226	0.701	Testis-expressed protein 11
18	9606.ENSP00000255324	0.690	RING finger protein 17
19	9606.ENSP00000346065	0.666	Tudor domain-containing protein 6
20	9606.ENSP00000304192	0.628	Pecanex-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043167	0.995	ion binding
GO:0003723	0.995	RNA binding
GO:0017076	0.995	purine nucleotide binding
GO:0032553	0.995	ribonucleotide binding
GO:0005515	0.986	protein binding
GO:0032559	0.986	adenyl ribonucleotide binding
GO:0035639	0.985	purine ribonucleoside triphosphate binding
GO:0005524	0.975	ATP binding
GO:0043169	0.966	cation binding
GO:0046872	0.855	metal ion binding
GO:0003824	0.846	catalytic activity
GO:0000287	0.841	magnesium ion binding
GO:0140098	0.821	catalytic activity, acting on RNA
GO:0003724	0.564	RNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0032502	0.942	developmental process
GO:0032501	0.936	multicellular organismal process
GO:0022412	0.929	cellular process involved in reproduction in multicellular organism
GO:0007276	0.924	gamete generation
GO:0003006	0.870	developmental process involved in reproduction
GO:0048468	0.794	cell development
GO:0007283	0.781	spermatogenesis
GO:0007281	0.715	germ cell development
GO:0065007	0.591	biological regulation
GO:0050789	0.576	regulation of biological process
GO:0071704	0.560	organic substance metabolic process
GO:0044238	0.554	primary metabolic process
GO:0044237	0.554	cellular metabolic process
GO:0006807	0.498	nitrogen compound metabolic process
GO:0019222	0.439	regulation of metabolic process
GO:0060255	0.432	regulation of macromolecule metabolic process
GO:0010468	0.410	regulation of gene expression
GO:0043170	0.388	macromolecule metabolic process
GO:0090304	0.364	nucleic acid metabolic process
GO:0048519	0.348	negative regulation of biological process
GO:0071840	0.337	cellular component organization or biogenesis
GO:0050794	0.335	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0043227	0.975	membrane-bounded organelle
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0005634	0.865	nucleus
GO:0016020	0.846	membrane
GO:0099080	0.757	supramolecular complex
GO:0070013	0.755	intracellular organelle lumen
GO:0035770	0.736	ribonucleoprotein granule
GO:0036464	0.732	cytoplasmic ribonucleoprotein granule
GO:0031981	0.556	nuclear lumen
GO:0012505	0.377	endomembrane system
GO:0043186	0.375	P granule
GO:0032991	0.361	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.564	RNA helicase.

[back to server]