StarFunc result for job id Q9BXT8

User Input

>input (1623 residues)
MAAEASKTGPSRSSYQRMGRKSQPWGAAEIQCTRCGRRVSRSSGHHCELQCGHAFCELCL
LMTEECTTIICPDCEVATAVNTRQRYYPMAGYIKEDSIMEKLQPKTIKNCSQDFKKTADQ
LTTGLERSASTDKTLLNSSAVMLDTNTAEEIDEALNTAHHSFEQLSIAGKALEHMQKQTI
EERERVIEVVEKQFDQLLAFFDSRKKNLCEEFARTTDDYLSNLIKAKSYIEEKKNNLNAA
MNIARALQLSPSLRTYCDLNQIIRTLQLTSDSELAQVSSPQLRNPPRLSVNCSEIICMFN
NMGKIEFRDSTKCYPQENEIRQNVQKKYNNKKELSCYDTYPPLEKKKVDMSVLTSEAPPP
PLQPETNDVHLEAKNFQPQKDVATASPKTIAVLPQMGSSPDVIIEEIIEDNVESSAELVF
VSHVIDPCHFYIRKYSQIKDAKVLEKKVNEFCNRSSHLDPSDILELGARIFVSSIKNGMW
CRGTITELIPIEGRNTRKPCSPTRLFVHEVALIQIFMVDFGNSEVLIVTGVVDTHVRPEH
SAKQHIALNDLCLVLRKSEPYTEGLLKDIQPLAQPCSLKDIVPQNSNEGWEEEAKVEFLK
MVNNKAVSMKVFREEDGVLIVDLQKPPPNKISSDMPVSLRDALVFMELAKFKSQSLRSHF
EKNTTLHYHPPILPKEMTDVSVTVCHINSPGDFYLQLIEGLDILFLLKTIEEFYKSEDGE
NLEILCPVQDQACVAKFEDGIWYRAKVIGLPGHQEVEVKYVDFGNTAKITIKDVRKIKDE
FLNAPEKAIKCKLAYIEPYKRTMQWSKEAKEKFEEKAQDKFMTCSVIKILEDNVLLVELF
DSLGAPEMTTTSINDQLVKEGLASYEIGYILKDNSQKHIEVWDPSPEEIISNEVHNLNPV
SAKSLPNENFQSLYNKELPVHICNVISPEKIYVQWLLTENLLNSLEEKMIAAYENSKWEP
VKWENDMHCAVKIQDKNQWRRGQIIRMVTDTLVEVLLYDVGVELVVNVDCLRKLEENLKT
MGRLSLECSLVDIRPAGGSDKWTATACDCLSLYLTGAVATIILQVDSEENNTTWPLPVKI
FCRDEKGERVDVSKYLIKKGLALRERRINNLDNSHSLSEKSLEVPLEQEDSVVTNCIKTN
FDPDKKTADIISEQKVSEFQEKILEPRTTRGYKPPAIPNMNVFEATVSCVGDDGTIFVVP
KLSEFELIKMTNEIQSNLKCLGLLEPYFWKKGEACAVRGSDTLWYRGKVMEVVGGAVRVQ
YLDHGFTEKIPQCHLYPILLYPDIPQFCIPCQLHNTTPVGNVWQPDAIEVLQQLLSKRQV
DIHIMELPKNPWEKLSIHLYFDGMSLSYFMAYYKYCTSEHTEEMLKEKPRSDHDKKYEEE
QWEIRFEELLSAETDTPLLPPYLSSSLPSPGELYAVQVKHVVSPNEVYICLDSIETSNQS
NQHSDTDDSGVSGESESESLDEALQRVNKKVEALPPLTDFRTEMPCLAEYDDGLWYRAKI
VAIKEFNPLSILVQFVDYGSTAKLTLNRLCQIPSHLMRYPARAIKVLLAGFKPPLRDLGE
TRIPYCPKWSMEALWAMIDCLQGKQLYAVSMAPAPEQIVTLYDDEQHPVHMPLVEMGLAD
KDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99MV7	0.304	0.301	0.000	1640	0.751	0.743	Q99MV7.pdb.gz	RNF17_MOUSE RING finger protein 17 OS=Mus musculus OX=10090 GN=Rnf17 PE=1 SV=2
2	AFDB:P61407	0.124	0.097	5.093E-61	2134	0.151	0.115	P61407.pdb.gz	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
3	AFDB:Q99MV1	0.118	0.161	6.561E-58	1172	0.133	0.184	Q99MV1.pdb.gz	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
4	AFDB:P34344	0.111	0.278	2.734E-24	610	0.057	0.152	P34344.pdb.gz	TG250_CAEEL Putative protein tag-250 OS=Caenorhabditis elegans OX=6239 GN=tag-250 PE=1 SV=2
5	AFDB:Q7ZT42	0.104	0.183	8.634E-24	897	0.086	0.156	Q7ZT42.pdb.gz	SND1_DANRE Staphylococcal nuclease domain-containing protein 1 OS=Danio rerio OX=7955 GN=snd1 PE=2 SV=1
6	AFDB:A0A140VK49	0.106	0.185	1.456E-23	910	0.096	0.170	A0A140VK49.pdb.gz	A0A140VK49_HUMAN Staphylococcal nuclease domain-containing protein OS=Homo sapiens OX=9606 GN=SND1 PE=2 SV=1
7	AFDB:Q9Y7U7	0.110	0.191	5.924E-20	878	0.075	0.139	Q9Y7U7.pdb.gz	SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snd1 PE=1 SV=1
8	AFDB:Q9Y2W6	0.110	0.312	5.845E-15	561	0.041	0.119	Q9Y2W6.pdb.gz	TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH PE=1 SV=2
9	AFDB:Q14BI7	0.108	0.125	1.494E-13	1383	0.033	0.038	Q14BI7.pdb.gz	TDRD9_MOUSE ATP-dependent RNA helicase TDRD9 OS=Mus musculus OX=10090 GN=Tdrd9 PE=1 SV=3
10	AFDB:Q99MW1	0.113	0.177	7.108E-10	1018	0.026	0.042	Q99MW1.pdb.gz	STK31_MOUSE Serine/threonine-protein kinase 31 OS=Mus musculus OX=10090 GN=Stk31 PE=1 SV=2
11	PDB:6tedZ	0.042	0.103	7.455E-5	510	0.032	0.102	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
12	PDB:7okyZ	0.039	0.128	3.058E-4	374	0.025	0.110	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
13	PDB:7uy7A	0.049	0.078	3.960E-3	552	0.038	0.112	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
14	PDB:7dvq3	0.054	0.064	4.173E-3	1193	0.052	0.070	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:3mp8A	0.037	0.105	1.069E-2	513	0.015	0.049	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
16	PDB:7abi7	0.034	0.213	2.109E-2	236	0.017	0.114	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
17	PDB:7r1dC	0.033	0.250	3.041E-2	192	0.012	0.104	7r1dC.pdb.gz
18	PDB:4zn3A	0.033	0.322	4.620E-2	147	0.009	0.095	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
19	PDB:6hivDA	0.042	0.043	4.620E-2	1557	0.023	0.024	6hivDA.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:6hiyDA	0.042	0.045	4.620E-2	1426	0.023	0.027	6hiyDA.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99MV7	0.0	2427	1640	0.752	0.745	RNF17_MOUSE RING finger protein 17 OS=Mus musculus OX=10090 GN=Rnf17 PE=1 SV=2
2	A9CPT4	1.33e-24	114	1133	0.105	0.150	TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes OX=8090 GN=tdrd1 PE=2 SV=1
3	Q9BXT4	1.25e-21	105	1180	0.094	0.130	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
4	Q99MV1	8.07e-21	102	1172	0.097	0.134	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
5	Q58EK5	3.22e-19	97.1	1175	0.118	0.163	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
6	Q8MTA5	1.51e-16	88.6	1527	0.110	0.117	Q8MTA5_DROME AT14886p OS=Drosophila melanogaster OX=7227 GN=qin PE=2 SV=1
7	F1R237	1.89e-16	88.6	2117	0.073	0.056	TDRD6_DANRE Tudor domain-containing 6 OS=Danio rerio OX=7955 GN=tdrd6 PE=1 SV=2
8	Q9VE55	5.30e-16	87.0	1857	0.112	0.097	Q9VE55_DROME Qin OS=Drosophila melanogaster OX=7227 GN=qin PE=1 SV=4
9	A6NAF9	1.10e-12	75.9	1079	0.065	0.097	TRD7A_DANRE Tudor domain-containing protein 7A OS=Danio rerio OX=7955 GN=tdrd7a PE=2 SV=2
10	P61407	2.21e-12	75.1	2134	0.039	0.030	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
11	Q9Y2W6	2.18e-11	70.9	561	0.026	0.077	TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH PE=1 SV=2
12	E1C3S7	1.49e-10	68.9	1071	0.059	0.089	TDRD7_CHICK Tudor domain-containing protein 7 OS=Gallus gallus OX=9031 GN=TDRD7 PE=2 SV=1
13	P25823	2.85e-10	68.2	2515	0.066	0.043	TUD_DROME Maternal protein tudor OS=Drosophila melanogaster OX=7227 GN=tud PE=1 SV=2
14	Q90WE3	5.78e-10	67.0	1905	0.065	0.056	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
15	Q80VL1	5.87e-10	66.2	560	0.023	0.066	TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus OX=10090 GN=Tdrkh PE=1 SV=1
16	Q95RI6	9.00e-10	63.2	236	0.025	0.169	Q95RI6_DROME LD28079p OS=Drosophila melanogaster OX=7227 GN=spoon PE=2 SV=1
17	Q8K1H1	1.82e-09	65.1	1086	0.061	0.091	TDRD7_MOUSE Tudor domain-containing protein 7 OS=Mus musculus OX=10090 GN=Tdrd7 PE=1 SV=1
18	A0A140VK05	1.84e-09	65.1	903	0.023	0.042	A0A140VK05_HUMAN Testicular secretory protein Li 5 OS=Homo sapiens OX=9606 PE=2 SV=1
19	Q92667	1.84e-09	65.1	903	0.023	0.042	AKAP1_HUMAN A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1
20	Q9R1R4	1.90e-09	65.1	1113	0.059	0.086	TDRD7_RAT Tudor domain-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Tdrd7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05641 Agenet	5.9e-05	34.8	Agenet domain
2	PF10332 DUF2418	3.5e+02	13.2	Protein of unknown function (DUF2418)
3	PF09602 PhaP_Bmeg	2.6e+02	12.9	Polyhydroxyalkanoic acid inclusion protein (PhaP_Bmeg)
4	PF05458 Siva	3e+02	12.5	Cd27 binding protein (Siva)
5	PF00565 SNase	4	19.3	Staphylococcal nuclease homologue
6	PF00567 TUDOR	2.7e-79	274.5	Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255324

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349208	0.907	Piwi-like protein 2
2	9606.ENSP00000245255	0.887	Piwi-like protein 1
3	9606.ENSP00000299001	0.856	Piwi-like protein 4
4	9606.ENSP00000330031	0.809	Piwi-like protein 3
5	9606.ENSP00000390621	0.797	Putative ATP-dependent RNA helicase TDRD12
6	9606.ENSP00000357465	0.757	Tudor domain-containing protein 10
7	9606.ENSP00000442478	0.735	Stomatin-like protein 1
8	9606.ENSP00000356846	0.695	Protein maelstrom homolog
9	9606.ENSP00000262794	0.690	RNA helicase Mov10l1
10	9606.ENSP00000313885	0.689	Transmembrane protein 94
11	9606.ENSP00000475615	0.684	Spliceosome-associated protein CWC15 homolog
12	9606.ENSP00000382327	0.677	Epimerase family protein SDR39U1
13	9606.ENSP00000238994	0.667	Protein phosphatase 1 regulatory subunit 3C
14	9606.ENSP00000360116	0.667	Ubiquitin-conjugating enzyme E2 U
15	9606.ENSP00000218548	0.665	Potassium-transporting ATPase alpha chain 2
16	9606.ENSP00000453854	0.665	Selenocysteine insertion sequence-binding protein 2-like
17	9606.ENSP00000216274	0.646	Receptor-interacting serine/threonine-protein kinase 3
18	9606.ENSP00000216336	0.645	Cathepsin G
19	9606.ENSP00000244230	0.644	U3 small nucleolar ribonucleoprotein protein MPP10
20	9606.ENSP00000348132	0.644	Serine/threonine kinase 31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003723	0.472	RNA binding
GO:0003824	0.415	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0032501	0.943	multicellular organismal process
GO:0019953	0.937	sexual reproduction
GO:0022414	0.932	reproductive process
GO:0032502	0.926	developmental process
GO:0007283	0.923	spermatogenesis
GO:0048856	0.906	anatomical structure development
GO:0048515	0.906	spermatid differentiation
GO:0007281	0.890	germ cell development
GO:0007286	0.868	spermatid development
GO:0050789	0.479	regulation of biological process
GO:0008152	0.395	metabolic process
GO:0044238	0.394	primary metabolic process
GO:0071704	0.368	organic substance metabolic process
GO:0044237	0.326	cellular metabolic process
GO:0043170	0.304	macromolecule metabolic process
GO:0006807	0.302	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.958	intracellular organelle
GO:0043231	0.939	intracellular membrane-bounded organelle
GO:0005634	0.832	nucleus
GO:0005829	0.742	cytosol
GO:0043232	0.717	intracellular non-membrane-bounded organelle
GO:0070013	0.395	intracellular organelle lumen
GO:0012505	0.332	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]