StarFunc result for job id Q9BXW9

User Input

>input (1451 residues)
MVSKRRLSKSEDKESLTEDASKTRKQPLSKKTKKSHIANEVEENDSIFVKLLKISGIILK
TGESQNQLAVDQIAFQKKLFQTLRRHPSYPKIIEEFVSGLESYIEDEDSFRNCLLSCERL
QDEEASMGASYSKSLIKLLLGIDILQPAIIKTLFEKLPEYFFENKNSDEINIPRLIVSQL
KWLDRVVDGKDLTTKIMQLISIAPENLQHDIITSLPEILGDSQHADVGKELSDLLIENTS
LTVPILDVLSSLRLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISE
LREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFDVIKSAIRYEKTI
SEAWIKAIENTASVSEHKVFDLVMLFIIYSTNTQTKKYIDRVLRNKIRSGCIQEQLLQST
FSVHYLVLKDMCSSILSLAQSLLHSLDQSIISFGSLLYKYAFKFFDTYCQQEVVGALVTH
ICSGNEAEVDTALDVLLELVVLNPSAMMMNAVFVKGILDYLDNISPQQIRKLFYVLSTLA
FSKQNEASSHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQERA
NLSDEQCTQVTSLLQLVHSCSEQSPQASALYYDEFANLIQHEKLDPKALEWVGHTICNDF
QDAFVVDSCVVPEGDFPFPVKALYGLEEYDTQDGIAINLLPLLFSQDFAKDGGPVTSQES
GQKLVSPLCLAPYFRLLRLCVERQHNGNLEEIDGLLDCPIFLTDLEPGEKLESMSAKERS
FMCSLIFLTLNWFREIVNAFCQETSPEMKGKVLTRLKHIVELQIILEKYLAVTPDYVPPL
GNFDVETLDITPHTVTAISAKIRKKGKIERKQKTDGSKTSSSDTLSEEKNSECDPTPSHR
GQLNKEFTGKEEKTSLLLHNSHAFFRELDIEVFSILHCGLVTKFILDTEMHTEATEVVQL
GPPELLFLLEDLSQKLESMLTPPIARRVPFLKNKGSRNIGFSHLQQRSAQEIVHCVFQLL
TPMCNHLENIHNYFQCLAAENHGVVDGPGVKVQEYHIMSSCYQRLLQIFHGLFAWSGFSQ
PENQNLLYSALHVLSSRLKQGEHSQPLEELLSQSVHYLQNFHQSIPSFQCALYLIRLLMV
ILEKSTASAQNKEKIASLARQFLCRVWPSGDKEKSNISNDQLHALLCIYLEHTESILKAI
EEIAGVGVPELINSPKDASSSTFPTLTRHTFVVFFRVMMAELEKTVKKIEPGTAADSQQI
HEEKLLYWNMAVRDFSILINLIKVFDSHPVLHVCLKYGRLFVEAFLKQCMPLLDFSFRKH
REDVLSLLETFQLDTRLLHHLCGHSKIHQDTRLTQHVPLLKKTLELLVCRVKAMLTLNNC
REAFWLGNLKNRDLQGEEIKSQNSQESTADESEDDMSSQASKSKATEDGEEDEVSAGEKE
QDSDESYDDSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7kzvV	0.606	0.734	0.000	1155	0.793	0.996	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
2	PDB:7zf1B	0.590	0.714	0.000	1179	0.811	0.998	7zf1B.pdb.gz
3	AFDB:B3DJT4	0.872	0.876	0.000	1445	0.527	0.529	B3DJT4.pdb.gz	B3DJT4_DANRE FA complementation group D2 OS=Danio rerio OX=7955 GN=fancd2 PE=1 SV=1
4	AFDB:Q80V62	0.922	0.922	0.000	1450	0.752	0.752	Q80V62.pdb.gz	FACD2_MOUSE Fanconi anemia group D2 protein homolog OS=Mus musculus OX=10090 GN=Fancd2 PE=1 SV=2
5	AFDB:Q9BXW9	1.000	1.000	0.000	1451	1.000	1.000	Q9BXW9.pdb.gz	FACD2_HUMAN Fanconi anemia group D2 protein OS=Homo sapiens OX=9606 GN=FANCD2 PE=1 SV=2
6	AFDB:G3GX36	0.660	0.890	1.609E-91	1068	0.563	0.765	G3GX36.pdb.gz	G3GX36_CRIGR Fanconi anemia group D2 protein-like OS=Cricetulus griseus OX=10029 GN=I79_002348 PE=1 SV=1
7	PDB:3s4wB	0.727	0.909	3.980E-88	1146	0.620	0.785	3s4wB.pdb.gz
8	AFDB:Q8MYL1	0.750	0.737	4.343E-51	1478	0.223	0.219	Q8MYL1.pdb.gz	FACD2_DROME Fanconi anemia group D2 protein homolog OS=Drosophila melanogaster OX=7227 GN=Fancd2 PE=1 SV=1
9	AFDB:F4JIJ1	0.628	0.616	6.300E-50	1484	0.243	0.237	F4JIJ1.pdb.gz	F4JIJ1_ARATH Fanconi anemia group D2 protein OS=Arabidopsis thaliana OX=3702 GN=ATFANCD2 PE=1 SV=2
10	AFDB:Q55F81	0.744	0.622	7.893E-49	1758	0.230	0.190	Q55F81.pdb.gz	Q55F81_DICDI Fanconi anemia group D2 protein homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268216 PE=4 SV=1
11	AFDB:Q9U2H4	0.593	0.597	1.911E-34	1440	0.163	0.165	Q9U2H4.pdb.gz	Q9U2H4_CAEEL FANCD2 OS=Caenorhabditis elegans OX=6239 GN=fcd-2 PE=1 SV=3
12	PDB:6vaeA	0.457	0.536	6.934E-15	1198	0.115	0.139	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
13	PDB:7ay1A	0.408	0.537	8.164E-12	1033	0.101	0.141	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
14	PDB:6tnfB	0.358	0.479	4.792E-9	1014	0.097	0.139	6tnfB.pdb.gz
15	AFDB:P97536	0.192	0.214	2.655E-8	1230	0.110	0.130	P97536.pdb.gz	CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus OX=10116 GN=Cand1 PE=1 SV=1
16	PDB:4a0cA	0.168	0.196	2.682E-8	1155	0.116	0.145	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
17	AFDB:Q1ZXQ8	0.097	0.075	5.326E-8	2013	0.133	0.096	Q1ZXQ8.pdb.gz	MTAA_DICDI Centrosomal protein 224 OS=Dictyostelium discoideum OX=44689 GN=mtaA PE=1 SV=1
18	PDB:7mqaLM	0.101	0.079	1.447E-7	2041	0.114	0.081	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7sukSP	0.156	0.114	2.902E-7	2234	0.120	0.078	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
20	PDB:7mq8LM	0.098	0.078	3.010E-7	2005	0.112	0.081	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DJT4	0.0	1470	1445	0.518	0.520	B3DJT4_DANRE FA complementation group D2 OS=Danio rerio OX=7955 GN=fancd2 PE=1 SV=1
2	G3GX36	0.0	1640	1068	0.560	0.760	G3GX36_CRIGR Fanconi anemia group D2 protein-like OS=Cricetulus griseus OX=10029 GN=I79_002348 PE=1 SV=1
3	Q68Y81	0.0	1546	1439	0.567	0.572	Q68Y81_CHICK Fanconi anemia protein FANCD2 OS=Gallus gallus OX=9031 GN=fancd2 PE=1 SV=1
4	Q6WAS6	0.0	1465	1445	0.518	0.520	Q6WAS6_DANRE Fanconi anemia complementation group d2 OS=Danio rerio OX=7955 GN=fancd2 PE=1 SV=1
5	Q80V62	0.0	2182	1450	0.743	0.743	FACD2_MOUSE Fanconi anemia group D2 protein homolog OS=Mus musculus OX=10090 GN=Fancd2 PE=1 SV=2
6	Q9BXW9	0.0	2974	1451	1.000	1.000	FACD2_HUMAN Fanconi anemia group D2 protein OS=Homo sapiens OX=9606 GN=FANCD2 PE=1 SV=2
7	F4JIJ1	2.66e-83	303	1484	0.166	0.162	F4JIJ1_ARATH Fanconi anemia group D2 protein OS=Arabidopsis thaliana OX=3702 GN=ATFANCD2 PE=1 SV=2
8	Q8MYL1	7.36e-68	255	1478	0.239	0.235	FACD2_DROME Fanconi anemia group D2 protein homolog OS=Drosophila melanogaster OX=7227 GN=Fancd2 PE=1 SV=1
9	Q55F81	7.41e-58	223	1758	0.203	0.167	Q55F81_DICDI Fanconi anemia group D2 protein homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268216 PE=4 SV=1
10	Q8MSQ1	1.19e-18	86.3	150	0.032	0.307	Q8MSQ1_DROME SD22389p OS=Drosophila melanogaster OX=7227 GN=Fancd2 PE=2 SV=1
11	E5QCJ4	2.05e-04	48.1	495	0.034	0.099	E5QCJ4_CAEEL FANCD2 OS=Caenorhabditis elegans OX=6239 GN=fcd-2 PE=1 SV=1
12	D3YT99	4.01e-04	47.4	852	0.034	0.058	D3YT99_CAEEL FANCD2 OS=Caenorhabditis elegans OX=6239 GN=fcd-2 PE=1 SV=1
13	Q9U2H4	7.34e-04	46.6	1440	0.034	0.034	Q9U2H4_CAEEL FANCD2 OS=Caenorhabditis elegans OX=6239 GN=fcd-2 PE=1 SV=3
14	Q8N392	0.93	36.6	663	0.025	0.056	RHG18_HUMAN Rho GTPase-activating protein 18 OS=Homo sapiens OX=9606 GN=ARHGAP18 PE=1 SV=3
15	C9JJQ0	1.5	35.0	232	0.012	0.073	C9JJQ0_HUMAN Stromal antigen 1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=1
16	Q8WVM7	1.5	35.8	1258	0.012	0.014	STAG1_HUMAN Cohesin subunit SA-1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=3
17	Q9DGN1	1.6	35.8	1265	0.011	0.013	STAG1_XENLA Cohesin subunit SA-1 OS=Xenopus laevis OX=8355 GN=stag1 PE=1 SV=1
18	P54777	2.1	35.4	978	0.019	0.028	PEX6_RAT Peroxisomal ATPase PEX6 OS=Rattus norvegicus OX=10116 GN=Pex6 PE=1 SV=1
19	Q8K0Q5	3.0	34.7	663	0.026	0.057	RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus OX=10090 GN=Arhgap18 PE=1 SV=1
20	Q9D3E6	5.0	34.3	1258	0.012	0.014	STAG1_MOUSE Cohesin subunit SA-1 OS=Mus musculus OX=10090 GN=Stag1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14631 FancD2	0	2660.4	Fanconi anaemia protein FancD2 nuclease
2	PF14676 FANCI_S2	0.29	22.8	FANCI solenoid 2
3	PF12247 MKT1_N	5.8e+02	12.3	Temperature dependent protein affecting M2 dsRNA replication
4	PF16805 Trans_coact	74	14.9	Phage late-transcription coactivator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287647

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229769	0.999	Fanconi anemia group E protein
2	9606.ENSP00000310842	0.999	Fanconi anemia group I protein
3	9606.ENSP00000354497	0.999	Fanconi-associated nuclease 1
4	9606.ENSP00000369497	0.999	Breast cancer type 2 susceptibility protein
5	9606.ENSP00000385021	0.999	E3 ubiquitin-protein ligase FANCL
6	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
7	9606.ENSP00000289081	0.998	Fanconi anemia group C protein
8	9606.ENSP00000343526	0.998	Ubiquitin carboxyl-terminal hydrolase 1
9	9606.ENSP00000294008	0.997	Structure-specific endonuclease subunit SLX4
10	9606.ENSP00000367910	0.997	Fanconi anemia group G protein
11	9606.ENSP00000373952	0.996	Fanconi anemia group A protein
12	9606.ENSP00000382628	0.994	DNA endonuclease RBBP8
13	9606.ENSP00000278616	0.993	Serine-protein kinase ATM
14	9606.ENSP00000330875	0.993	Fanconi anemia group F protein
15	9606.ENSP00000356243	0.993	Ubiquitin-conjugating enzyme E2 T
16	9606.ENSP00000372088	0.992	DNA repair protein RAD51 homolog 1
17	9606.ENSP00000381378	0.992	Fanconi anemia group B protein
18	9606.ENSP00000388648	0.992	Serine/threonine-protein kinase Chk1
19	9606.ENSP00000267430	0.991	Fanconi anemia group M protein
20	9606.ENSP00000261584	0.990	Partner and localizer of BRCA2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070182	0.995	DNA polymerase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009314	0.949	response to radiation
GO:0010212	0.912	response to ionizing radiation
GO:0050789	0.875	regulation of biological process
GO:0009987	0.872	cellular process
GO:0050794	0.867	regulation of cellular process
GO:0051716	0.739	cellular response to stimulus
GO:0010332	0.737	response to gamma radiation
GO:0071704	0.665	organic substance metabolic process
GO:0006950	0.651	response to stress
GO:0044238	0.646	primary metabolic process
GO:0006807	0.639	nitrogen compound metabolic process
GO:0043170	0.635	macromolecule metabolic process
GO:0033554	0.610	cellular response to stress
GO:0044237	0.599	cellular metabolic process
GO:0006974	0.555	cellular response to DNA damage stimulus
GO:0006725	0.496	cellular aromatic compound metabolic process
GO:0090304	0.492	nucleic acid metabolic process
GO:0019222	0.485	regulation of metabolic process
GO:0006259	0.466	DNA metabolic process
GO:0060255	0.458	regulation of macromolecule metabolic process
GO:0006281	0.443	DNA repair
GO:0080090	0.386	regulation of primary metabolic process
GO:0051171	0.386	regulation of nitrogen compound metabolic process
GO:0071840	0.360	cellular component organization or biogenesis
GO:0016043	0.351	cellular component organization
GO:0048519	0.331	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0032991	0.986	protein-containing complex
GO:0005829	0.985	cytosol
GO:0005694	0.816	chromosome
GO:1902494	0.811	catalytic complex
GO:0005730	0.698	nucleolus
GO:0016604	0.671	nuclear body
GO:1990391	0.413	DNA repair complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]