StarFunc result for job id Q9BXX0

User Input

>input (1053 residues)
MWQPRRPWPRVPWRWALALLALVGAGLCHAGPQPGYPARPSARNKNWCAYIVNKNVSCSV
LEGSESFIQAQYNCAWNQMPCPSALVYRVNFRPRYVTRYKTVTQLEWRCCPGFRGGDCQE
GPKDPVKTLRPTPARPRNSLKKATDNEPSQFSEPRKTLSPTGTAQPSWGVDPKEGPQELQ
EKKIQVLEEKVLRLTRTVLDLQSSLAGVSENLKHATQDDASRTRAPGLSSQHPKPDTTVS
GDTETGQSPGVFNTKESGMKDIKSELAEVKDTLKNKSDKLEELDGKVKGYEGQLRQLQEA
AQGPTVTMTTNELYQAYVDSKIDALREELMEGMDRKLADLKNSCEYKLTGLQQQCDDYGS
SYLGVIELIGEKETSLRKEINNLRARLQEPSAQANCCDSEKNGDIGQQIKTLDQKIERVA
EATRMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAIN
GEVGDLKQLVDQKIQSLEDRLGSVLLQMTNNTGAELSPPGAAALPGVSGSGDERVMMELN
HLKDKVQVVEDICLLNIQGKPHGMEGALPNREDRAVRDSLHLLKSLNDTMHRKFQETEQT
IQKLQQDFSFLYSQLNHTENDVTHLQKEMSNCRAGENAGMGRFTKVGEQERTVDTLPSPQ
HPVAHCCSQLEERWQRLQSQVISELDACKECTQGVQREVSMVEGRVSHMEKTCSKLDSIS
GNLQRIKEGLNKHVSSLWNCVRQMNGTLRSHSRDISGLKNSVQQFYSHVFQISTDLQDLV
KFQPSAKAPSPPPPAEAPKEPLQPEPAPPRPSGPATAEDPGRRPVLPQRPPEERPPQPPG
STGVIAETGQAGPPAGAGVSGRGLPRGVDGQTGSGTVPGAEGFAGAPGYPKSPPVASPGA
PVPSLVSFSAGLTQKPFPSDGGVVLFNKVLVNDGDVYNPSTGVFTAPYDGRYLITATLTP
ERDAYVEAVLSVSNASVAQLHTAGYRREFLEYHRPPGALHTCGGPGAFHLIVHLKAGDAV
NVVVTGGKLAHTDFDEMYSTFSGVFLYPFLSHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXX0	1.000	1.000	0.000	1053	1.000	1.000	Q9BXX0.pdb.gz	EMIL2_HUMAN EMILIN-2 OS=Homo sapiens OX=9606 GN=EMILIN2 PE=1 SV=3
2	AFDB:Q8K482	0.327	0.322	4.951E-104	1074	0.745	0.730	Q8K482.pdb.gz	EMIL2_MOUSE EMILIN-2 OS=Mus musculus OX=10090 GN=Emilin2 PE=1 SV=1
3	AFDB:Q9Y6C2	0.127	0.132	2.611E-36	1016	0.264	0.274	Q9Y6C2.pdb.gz	EMIL1_HUMAN EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3
4	AFDB:B2RPV6	0.162	0.143	6.613E-17	1210	0.186	0.162	B2RPV6.pdb.gz	MMRN1_MOUSE Multimerin-1 OS=Mus musculus OX=10090 GN=Mmrn1 PE=1 SV=2
5	AFDB:F1SDV5	0.110	0.146	2.894E-15	766	0.163	0.225	F1SDV5.pdb.gz	F1SDV5_PIG Elastin microfibril interfacer 3 OS=Sus scrofa OX=9823 GN=EMILIN3 PE=4 SV=2
6	AFDB:O75973	0.126	0.475	7.091E-13	258	0.068	0.279	O75973.pdb.gz	C1QRF_HUMAN C1q-related factor OS=Homo sapiens OX=9606 GN=C1QL1 PE=1 SV=1
7	AFDB:Q8CFR0	0.111	0.381	4.959E-12	287	0.070	0.258	Q8CFR0.pdb.gz	C1QL2_MOUSE Complement C1q-like protein 2 OS=Mus musculus OX=10090 GN=C1ql2 PE=1 SV=1
8	AFDB:Q9ESN4	0.119	0.442	8.644E-12	255	0.066	0.275	Q9ESN4.pdb.gz	C1QL3_MOUSE Complement C1q-like protein 3 OS=Mus musculus OX=10090 GN=C1ql3 PE=1 SV=1
9	AFDB:Q02105	0.116	0.473	1.507E-11	246	0.062	0.264	Q02105.pdb.gz	C1QC_MOUSE Complement C1q subcomponent subunit C OS=Mus musculus OX=10090 GN=C1qc PE=1 SV=2
10	AFDB:P02746	0.119	0.469	2.350E-11	253	0.051	0.213	P02746.pdb.gz	C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens OX=9606 GN=C1QB PE=1 SV=3
11	PDB:5kc6B	0.109	0.735	1.517E-9	144	0.028	0.208	5kc6B.pdb.gz
12	PDB:5h4bA	0.115	0.804	7.190E-9	136	0.030	0.235	5h4bA.pdb.gz
13	PDB:7e57B	0.084	0.588	3.457E-4	123	0.022	0.187	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:7l2zF	0.067	0.101	1.550E-3	664	0.015	0.024	7l2zF.pdb.gz
15	PDB:5a3oA	0.067	0.431	3.567E-3	114	0.018	0.167	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
16	PDB:5eiyB	0.057	0.084	6.573E-3	658	0.015	0.024	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
17	PDB:6oj0A	0.076	0.329	2.494E-2	178	0.014	0.084	6oj0A.pdb.gz
18	PDB:4uybA	0.058	0.128	3.293E-2	401	0.016	0.042	4uybA.pdb.gz
19	PDB:4tlgA	0.046	0.110	4.597E-2	396	0.013	0.035	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
20	PDB:4bu2A	0.037	0.079	8.013E-2	379	0.013	0.037	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K482	0.0	1541	1074	0.748	0.734	EMIL2_MOUSE EMILIN-2 OS=Mus musculus OX=10090 GN=Emilin2 PE=1 SV=1
2	Q9BXX0	0.0	2182	1053	1.000	1.000	EMIL2_HUMAN EMILIN-2 OS=Homo sapiens OX=9606 GN=EMILIN2 PE=1 SV=3
3	F1SDV5	5.27e-56	210	766	0.196	0.269	F1SDV5_PIG Elastin microfibril interfacer 3 OS=Sus scrofa OX=9823 GN=EMILIN3 PE=4 SV=2
4	Q9NT22	1.59e-55	209	766	0.195	0.268	EMIL3_HUMAN EMILIN-3 OS=Homo sapiens OX=9606 GN=EMILIN3 PE=1 SV=2
5	P59900	1.61e-52	200	758	0.198	0.276	EMIL3_MOUSE EMILIN-3 OS=Mus musculus OX=10090 GN=Emilin3 PE=2 SV=1
6	F1QC17	1.96e-35	148	1014	0.110	0.114	EMI1A_DANRE EMILIN-1-A OS=Danio rerio OX=7955 GN=emilin1a PE=3 SV=1
7	Q5TZ63	1.83e-33	142	1008	0.120	0.125	Q5TZ63_DANRE EMILIN-1 precursor OS=Danio rerio OX=7955 GN=im:7159005 PE=1 SV=1
8	Q9Y6C2	1.16e-32	139	1016	0.133	0.138	EMIL1_HUMAN EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3
9	Q99K41	1.91e-29	129	1017	0.115	0.119	EMIL1_MOUSE EMILIN-1 OS=Mus musculus OX=10090 GN=Emilin1 PE=1 SV=1
10	Q96A83	3.64e-18	90.9	441	0.041	0.098	COQA1_HUMAN Collagen alpha-1(XXVI) chain OS=Homo sapiens OX=9606 GN=COL26A1 PE=1 SV=1
11	Q91VF6	2.21e-17	88.6	440	0.037	0.089	COQA1_MOUSE Collagen alpha-1(XXVI) chain OS=Mus musculus OX=10090 GN=Col26a1 PE=1 SV=1
12	Q91VF5	3.33e-14	78.6	444	0.040	0.095	EMID1_MOUSE EMI domain-containing protein 1 OS=Mus musculus OX=10090 GN=Emid1 PE=2 SV=1
13	A6H6E2	2.46e-11	70.5	943	0.094	0.105	MMRN2_MOUSE Multimerin-2 OS=Mus musculus OX=10090 GN=Mmrn2 PE=1 SV=1
14	Q9H8L6	9.91e-10	65.5	949	0.032	0.036	MMRN2_HUMAN Multimerin-2 OS=Homo sapiens OX=9606 GN=MMRN2 PE=1 SV=2
15	Q13201	1.33e-08	61.6	1228	0.091	0.078	MMRN1_HUMAN Multimerin-1 OS=Homo sapiens OX=9606 GN=MMRN1 PE=1 SV=3
16	Q9PT14	4.69e-08	56.2	182	0.040	0.231	Q9PT14_ONCMY Precerebellin-like protein OS=Oncorhynchus mykiss OX=8022 GN=CBLNL PE=2 SV=2
17	B2RPV6	1.71e-07	58.2	1210	0.029	0.026	MMRN1_MOUSE Multimerin-1 OS=Mus musculus OX=10090 GN=Mmrn1 PE=1 SV=2
18	Q86Z23	2.01e-06	52.4	238	0.060	0.265	C1QL4_HUMAN Complement C1q-like protein 4 OS=Homo sapiens OX=9606 GN=C1QL4 PE=1 SV=1
19	Q8BVD7	1.07e-05	50.8	289	0.044	0.159	C1QT7_MOUSE Complement C1q tumor necrosis factor-related protein 7 OS=Mus musculus OX=10090 GN=C1qtnf7 PE=2 SV=2
20	Q4ZJN1	1.08e-04	48.1	333	0.070	0.222	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16326 ABC_tran_CTD	39	15.9	ABC transporter C-terminal domain
2	PF01442 Apolipoprotein	18	16.6	Apolipoprotein A1/A4/E domain
3	PF04108 ATG17_like	0.0033	28.5	Autophagy protein ATG17-like domain
4	PF05791 Bacillus_HBL	8	17.8	Bacillus haemolytic enterotoxin (HBL)
5	PF04513 Baculo_PEP_C	7	18.1	Baculovirus polyhedron envelope protein, PEP, C terminus
6	PF10046 BLOC1_2	0.0017	30.0	Biogenesis of lysosome-related organelles complex-1 subunit 2
7	PF00386 C1q	1.4e-08	46.4	C1q domain
8	PF16566 CREPT	1.7e+02	13.7	Cell-cycle alteration and expression-elevated protein in tumour
9	PF07889 DUF1664	0.001	30.5	Protein of unknown function (DUF1664)
10	PF12889 DUF3829	5.3e+02	11.5	Protein of unknown function (DUF3829)
11	PF16888 DUF5082	1.9	20.2	Domain of unknown function (DUF5082)
12	PF06103 DUF948	44	15.7	Bacterial protein of unknown function (DUF948)
13	PF07546 EMI	2.4e-14	65.1	EMI domain
14	PF02601 Exonuc_VII_L	27	15.8	Exonuclease VII, large subunit
15	PF06818 Fez1	9	18.2	Fez1
16	PF00038 Filament	3.5e+02	12.2	Intermediate filament protein
17	PF13851 GAS	35	15.2	Growth-arrest specific micro-tubule binding
18	PF14389 Lzipper-MIP1	1.3	20.7	Leucine-zipper of ternary complex factor MIP1
19	PF05816 TelA	1.2e+02	13.2	Toxic anion resistance protein (TelA)
20	PF12718 Tropomyosin_1	8e+02	11.6	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254528

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336587	0.700	Cerebellar degeneration related protein 2 like
2	9606.ENSP00000420270	0.591	Serine/threonine-protein kinase Kist
3	9606.ENSP00000307741	0.582	CKLF like MARVEL transmembrane domain containing 8
4	9606.ENSP00000283632	0.542	Protein RMD5 homolog A
5	9606.ENSP00000441726	0.518	Clusterin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0048518	0.990	positive regulation of biological process
GO:0080134	0.988	regulation of response to stress
GO:0032101	0.986	regulation of response to external stimulus
GO:0050794	0.983	regulation of cellular process
GO:0051239	0.967	regulation of multicellular organismal process
GO:0048584	0.921	positive regulation of response to stimulus
GO:0048519	0.883	negative regulation of biological process
GO:0048522	0.879	positive regulation of cellular process
GO:0051240	0.735	positive regulation of multicellular organismal process
GO:0032103	0.669	positive regulation of response to external stimulus
GO:0009987	0.655	cellular process
GO:0050865	0.655	regulation of cell activation
GO:0030155	0.645	regulation of cell adhesion
GO:0048523	0.621	negative regulation of cellular process
GO:0031347	0.617	regulation of defense response
GO:0040012	0.612	regulation of locomotion
GO:0010543	0.592	regulation of platelet activation
GO:0030334	0.417	regulation of cell migration
GO:0050793	0.408	regulation of developmental process
GO:0061041	0.386	regulation of wound healing
GO:1900426	0.385	positive regulation of defense response to bacterium
GO:0034110	0.347	regulation of homotypic cell-cell adhesion
GO:0045785	0.324	positive regulation of cell adhesion
GO:0022603	0.308	regulation of anatomical structure morphogenesis
GO:2000026	0.304	regulation of multicellular organismal development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.996	collagen-containing extracellular matrix
GO:0005576	0.980	extracellular region
GO:0005622	0.703	intracellular anatomical structure
GO:0043226	0.641	organelle
GO:0031981	0.498	nuclear lumen
GO:0005654	0.478	nucleoplasm
GO:0005737	0.409	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]