StarFunc result for job id Q9BXY4

User Input

>input (272 residues)
MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPR
LFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYL
HLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREII
QHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLES
SKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXY4	1.000	1.000	3.902E-50	272	1.000	1.000	Q9BXY4.pdb.gz	RSPO3_HUMAN R-spondin-3 OS=Homo sapiens OX=9606 GN=RSPO3 PE=1 SV=1
2	AFDB:Q2TJ95	0.743	0.730	1.440E-43	277	0.860	0.845	Q2TJ95.pdb.gz	RSPO3_MOUSE R-spondin-3 OS=Mus musculus OX=10090 GN=Rspo3 PE=1 SV=2
3	AFDB:Q5R328	0.446	0.386	1.097E-28	317	0.460	0.394	Q5R328.pdb.gz	RSPO3_DANRE R-spondin-3 OS=Danio rerio OX=7955 GN=rspo3 PE=2 SV=2
4	AFDB:Q9Z132	0.429	0.433	2.584E-26	265	0.408	0.419	Q9Z132.pdb.gz	RSPO1_MOUSE R-spondin-1 OS=Mus musculus OX=10090 GN=Rspo1 PE=1 SV=1
5	AFDB:Q2MKA7	0.369	0.381	9.154E-26	263	0.408	0.422	Q2MKA7.pdb.gz	RSPO1_HUMAN R-spondin-1 OS=Homo sapiens OX=9606 GN=RSPO1 PE=1 SV=1
6	AFDB:Q6DHR0	0.374	0.388	2.042E-24	261	0.419	0.437	Q6DHR0.pdb.gz	RSPO1_DANRE R-spondin-1 OS=Danio rerio OX=7955 GN=rspo1 PE=2 SV=1
7	AFDB:Q6UXX9	0.389	0.432	5.426E-24	243	0.415	0.465	Q6UXX9.pdb.gz	RSPO2_HUMAN R-spondin-2 OS=Homo sapiens OX=9606 GN=RSPO2 PE=1 SV=2
8	AFDB:F1Q5C9	0.385	0.420	2.419E-23	248	0.371	0.407	F1Q5C9.pdb.gz	F1Q5C9_DANRE R-spondin 2 OS=Danio rerio OX=7955 GN=si:ch211-149p10.1 PE=2 SV=1
9	AFDB:Q2I0M5	0.421	0.476	7.193E-22	234	0.316	0.368	Q2I0M5.pdb.gz	RSPO4_HUMAN R-spondin-4 OS=Homo sapiens OX=9606 GN=RSPO4 PE=1 SV=2
10	AFDB:A2BFS0	0.194	0.073	4.586E-5	766	0.110	0.039	A2BFS0.pdb.gz
11	PDB:1w0rA	0.168	0.110	4.412E-3	442	0.136	0.084	1w0rA.pdb.gz
12	PDB:7nydE	0.187	0.108	1.045E-2	484	0.044	0.025	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
13	PDB:4e0sB	0.172	0.057	1.173E-2	898	0.077	0.023	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
14	PDB:3t5oA	0.188	0.065	2.338E-2	871	0.044	0.014	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
15	PDB:7nydG	0.186	0.128	2.476E-2	413	0.055	0.036	7nydG.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:3ojyB	0.173	0.096	4.154E-2	504	0.055	0.030	3ojyB.pdb.gz	Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
17	PDB:7nycC	0.161	0.058	6.580E-2	809	0.110	0.037	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:6pyhD	0.123	0.061	6.970E-2	798	0.129	0.044	6pyhD.pdb.gz
19	PDB:7nycD	0.186	0.107	6.970E-2	487	0.059	0.033	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7nycG	0.186	0.133	9.841E-2	393	0.059	0.041	7nycG.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXY4	0.0	560	272	1.000	1.000	RSPO3_HUMAN R-spondin-3 OS=Homo sapiens OX=9606 GN=RSPO3 PE=1 SV=1
2	Q2TJ95	4.20e-160	447	277	0.882	0.866	RSPO3_MOUSE R-spondin-3 OS=Mus musculus OX=10090 GN=Rspo3 PE=1 SV=2
3	Q5R328	1.48e-79	244	317	0.456	0.391	RSPO3_DANRE R-spondin-3 OS=Danio rerio OX=7955 GN=rspo3 PE=2 SV=2
4	Q6DHR0	8.85e-76	233	261	0.438	0.456	RSPO1_DANRE R-spondin-1 OS=Danio rerio OX=7955 GN=rspo1 PE=2 SV=1
5	Q2MKA7	3.96e-75	231	263	0.412	0.426	RSPO1_HUMAN R-spondin-1 OS=Homo sapiens OX=9606 GN=RSPO1 PE=1 SV=1
6	Q9Z132	4.29e-73	226	265	0.401	0.411	RSPO1_MOUSE R-spondin-1 OS=Mus musculus OX=10090 GN=Rspo1 PE=1 SV=1
7	Q6UXX9	8.41e-65	204	243	0.382	0.428	RSPO2_HUMAN R-spondin-2 OS=Homo sapiens OX=9606 GN=RSPO2 PE=1 SV=2
8	F1Q5C9	2.77e-63	201	248	0.375	0.411	F1Q5C9_DANRE R-spondin 2 OS=Danio rerio OX=7955 GN=si:ch211-149p10.1 PE=2 SV=1
9	Q8BFU0	8.84e-63	199	243	0.371	0.416	RSPO2_MOUSE R-spondin-2 OS=Mus musculus OX=10090 GN=Rspo2 PE=1 SV=1
10	Q2I0M5	1.42e-46	157	234	0.290	0.338	RSPO4_HUMAN R-spondin-4 OS=Homo sapiens OX=9606 GN=RSPO4 PE=1 SV=2
11	P29122	3.59e-07	53.5	969	0.147	0.041	PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens OX=9606 GN=PCSK6 PE=1 SV=1
12	Q62030	7.56e-06	49.3	932	0.140	0.041	Q62030_MOUSE PACE4A (Fragment) OS=Mus musculus OX=10090 GN=Pcsk6 PE=2 SV=1
13	F6XJP7	7.67e-06	49.3	959	0.140	0.040	F6XJP7_MOUSE Proprotein convertase subtilisin/kexin type 6 OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=1
14	E9Q4D0	8.00e-06	49.3	946	0.140	0.040	E9Q4D0_MOUSE Proprotein convertase subtilisin/kexin type 6 OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=2
15	H3BJL4	9.42e-06	48.9	798	0.140	0.048	H3BJL4_MOUSE Proprotein convertase subtilisin/kexin type 6 (Fragment) OS=Mus musculus OX=10090 GN=Pcsk6 PE=1 SV=1
16	P30432	1.59e-05	48.5	1679	0.129	0.021	FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster OX=7227 GN=Fur2 PE=2 SV=2
17	Q04592	2.54e-05	47.8	1877	0.129	0.019	PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus OX=10090 GN=Pcsk5 PE=1 SV=3
18	A7MBS7	2.73e-05	47.8	1686	0.088	0.014	THS7A_DANRE Thrombospondin type-1 domain-containing protein 7A OS=Danio rerio OX=7955 GN=thsd7aa PE=1 SV=2
19	P14616	7.98e-05	46.2	1297	0.110	0.023	INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens OX=9606 GN=INSRR PE=1 SV=2
20	F1Q633	8.11e-05	46.2	3970	0.118	0.008	F1Q633_DANRE Extracellular matrix protein FRAS1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15913 Furin-like_2	7.8e-41	149.8	Furin-like repeat, cysteine-rich
2	PF19028 TSP1_spondin	4e-09	48.0	Spondin-like TSP1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349131

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368516	0.991	Leucine-rich repeat-containing G-protein coupled receptor 4
2	9606.ENSP00000443824	0.990	E3 ubiquitin-protein ligase ZNRF3
3	9606.ENSP00000266674	0.954	Leucine-rich repeat-containing G-protein coupled receptor 5
4	9606.ENSP00000463069	0.944	E3 ubiquitin-protein ligase RNF43
5	9606.ENSP00000276659	0.913	R-spondin-2
6	9606.ENSP00000217260	0.908	R-spondin-4
7	9606.ENSP00000348944	0.908	R-spondin-1
8	9606.ENSP00000272317	0.903	Ubiquitin-40S ribosomal protein S27a
9	9606.ENSP00000304697	0.903	Polyubiquitin-B
10	9606.ENSP00000441543	0.903	Polyubiquitin-C
11	9606.ENSP00000300305	0.900	Runt-related transcription factor 1
12	9606.ENSP00000361818	0.900	Syndecan-4
13	9606.ENSP00000365380	0.900	Forkhead box protein P3
14	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
15	9606.ENSP00000415151	0.900	Core-binding factor subunit beta
16	9606.ENSP00000356247	0.829	Leucine-rich repeat-containing G-protein coupled receptor 6
17	9606.ENSP00000357196	0.707	Receptor-type tyrosine-protein phosphatase kappa
18	9606.ENSP00000261349	0.699	Low-density lipoprotein receptor-related protein 6
19	9606.ENSP00000483552	0.648	Furin
20	9606.ENSP00000264634	0.646	Protein Wnt-5a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048522	0.993	positive regulation of cellular process
GO:0030111	0.946	regulation of Wnt signaling pathway
GO:0023056	0.939	positive regulation of signaling
GO:0010647	0.938	positive regulation of cell communication
GO:0048584	0.928	positive regulation of response to stimulus
GO:0009967	0.922	positive regulation of signal transduction
GO:0032501	0.917	multicellular organismal process
GO:0030177	0.909	positive regulation of Wnt signaling pathway
GO:0032502	0.901	developmental process
GO:0009987	0.899	cellular process
GO:0048856	0.838	anatomical structure development
GO:2000050	0.798	regulation of non-canonical Wnt signaling pathway
GO:0007275	0.712	multicellular organism development
GO:0050896	0.540	response to stimulus
GO:0050793	0.516	regulation of developmental process
GO:0048731	0.509	system development
GO:0051716	0.438	cellular response to stimulus
GO:0060828	0.437	regulation of canonical Wnt signaling pathway
GO:0048519	0.434	negative regulation of biological process
GO:0007154	0.423	cell communication
GO:0023052	0.416	signaling
GO:0007165	0.409	signal transduction
GO:0198738	0.372	cell-cell signaling by wnt
GO:1905114	0.360	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0048513	0.307	animal organ development
GO:0060255	0.302	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0043227	0.606	membrane-bounded organelle
GO:0005622	0.591	intracellular anatomical structure
GO:0043231	0.568	intracellular membrane-bounded organelle
GO:0071944	0.436	cell periphery
GO:0016020	0.395	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]