StarFunc result for job id Q9BY07

User Input

>input (1137 residues)
MKVKEEKAGVGKLDHTNHRRRFPDQKECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWG
LRPDQPQQELTGPGSGASSQDSSMDLISRTRSPAAEQLQDILGEEDEAPNPTLFTEMDTL
QHDGDQMEWKESARWIKFEEKVEEGGERWSKPHVSTLSLHSLFELRTCLQTGTVLLDLDS
GSLPQIIDDVIEKQIEDGLLRPELRERVSYVLLRRHRHQTKKPIHRSLADIGKSVSTTNR
SPARSPGAGPSLHHSTEDLRMRQSANYGRLCHAQSRSMNDISLTPNTDQRKNKFMKKIPK
DSEASNVLVGEVDFLDQPFIAFVRLIQSAMLGGVTEVPVPTRFLFILLGPSGRAKSYNEI
GRAIATLMVDDLFSDVAYKARNREDLIAGIDEFLDEVIVLPPGEWDPNIRIEPPKKVPSA
DKRKSVFSLAELGQMNGSVGGGGGAPGGGNGGGGGGGSGGGAGSGGAGGTSSGDDGEMPA
MHEIGEELIWTGRFFGGLCLDIKRKLPWFPSDFYDGFHIQSISAILFIYLGCITNAITFG
GLLGDATDNYQGVMESFLGTAMAGSLFCLFSGQPLIILSSTGPILIFEKLLFDFSKGNGL
DYMEFRLWIGLHSAVQCLILVATDASFIIKYITRFTEEGFSTLISFIFIYDAIKKMIGAF
KYYPINMDFKPNFITTYKCECVAPDTVNTTVFNASAPLAPDTNASLYNLLNLTALDWSLL
SKKECLSYGGRLLGNSCKFIPDLALMSFILFFGTYSMTLTLKKFKFSRYFPTKVRALVAD
FSIVFSILMFCGIDACFGLETPKLHVPSVIKPTRPDRGWFVAPFGKNPWWVYPASILPAL
LVTILIFMDQQITAVIVNRKENKLKKAAGYHLDLFWVGILMALCSFMGLPWYVAATVISI
AHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPILKCIPLPVLYGVF
LYMGVASLNGIQMGTGGSEFKIQKKLTPFWERCKLFLMPAKHQPDHAFLRHVPLRRIHLF
TLVQILCLAVLWILKSTVAAIIFPVMILGLIIVRRLLDFIFSQHDLAWIDNILPEKEKKE
TDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8PYB9	0.513	0.523	0.000	1114	0.589	0.601	A0A2R8PYB9.pdb.gz
2	AFDB:E9Q3M5	0.883	0.899	0.000	1116	0.892	0.909	E9Q3M5.pdb.gz	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
3	AFDB:F1QHT2	0.519	0.545	0.000	1082	0.584	0.614	F1QHT2.pdb.gz
4	AFDB:O13134	0.508	0.555	0.000	1035	0.584	0.642	O13134.pdb.gz	S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum OX=8305 GN=SLC4A4 PE=2 SV=1
5	AFDB:O88343	0.523	0.550	0.000	1079	0.592	0.624	O88343.pdb.gz	S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus OX=10090 GN=Slc4a4 PE=1 SV=2
6	AFDB:Q9BY07	1.000	1.000	0.000	1137	1.000	1.000	Q9BY07.pdb.gz	S4A5_HUMAN Electrogenic sodium bicarbonate cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC4A5 PE=2 SV=2
7	AFDB:Q9R1N3	0.506	0.474	1.226E-90	1218	0.456	0.425	Q9R1N3.pdb.gz	S4A7_RAT Sodium bicarbonate cotransporter 3 OS=Rattus norvegicus OX=10116 GN=Slc4a7 PE=1 SV=1
8	AFDB:Q5DTL9	0.525	0.534	3.820E-90	1118	0.459	0.467	Q5DTL9.pdb.gz	S4A10_MOUSE Sodium-driven chloride bicarbonate exchanger OS=Mus musculus OX=10090 GN=Slc4a10 PE=1 SV=2
9	AFDB:Q2Y0W8	0.501	0.520	1.788E-88	1093	0.451	0.469	Q2Y0W8.pdb.gz	S4A8_HUMAN Electroneutral sodium bicarbonate exchanger 1 OS=Homo sapiens OX=9606 GN=SLC4A8 PE=1 SV=1
10	AFDB:M9PB60	0.627	0.633	1.758E-86	1126	0.422	0.426	M9PB60.pdb.gz	M9PB60_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
11	PDB:8cs9g	0.443	0.599	5.519E-58	832	0.288	0.393	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:7tvzA	0.461	0.604	2.198E-55	850	0.283	0.379	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
13	PDB:6caaA	0.399	0.929	1.376E-38	477	0.308	0.734	6caaA.pdb.gz
14	PDB:4yzfA	0.401	0.945	1.289E-30	475	0.177	0.423	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
15	PDB:5l25A	0.302	0.797	1.212E-12	399	0.099	0.281	5l25A.pdb.gz
16	PDB:7lguA	0.293	0.465	9.426E-9	680	0.053	0.088	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
17	PDB:7ch1A	0.257	0.425	4.280E-6	640	0.053	0.094	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
18	PDB:3qe7A	0.222	0.508	9.953E-5	407	0.070	0.197	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
19	PDB:1a6jB	0.068	0.439	4.141E-2	157	0.015	0.108	1a6jB.pdb.gz
20	PDB:7lciR	0.063	0.117	1.752E-1	393	0.041	0.120	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096X8J7	621	1170	0.320	0.311	B3A3_DANRE Anion exchange protein 3 OS=Danio rerio OX=7955 GN=Slc4a3 PE=2 SV=1
2	A0A2R8QD45	1263	1073	0.572	0.606	A0A2R8QD45_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=id:ibd2520 PE=1 SV=1
3	A0A494BA31	794	952	0.391	0.467	B3A4_MOUSE Anion exchange protein 4 OS=Mus musculus OX=10090 GN=Slc4a9 PE=1 SV=1
4	A0A494BAI0	654	871	0.334	0.436	A0A494BAI0_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
5	A0A494BAK5	719	821	0.344	0.476	A0A494BAK5_MOUSE Anion exchange protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
6	A0A494BBC3	730	918	0.372	0.461	A0A494BBC3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
7	A9NIM6	625	1232	0.328	0.303	A9NIM6_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2.1 PE=1 SV=1
8	B0S7B8	591	1228	0.328	0.304	B0S7B8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2 PE=3 SV=1
9	B3WFV9	722	1215	0.354	0.331	B3WFV9_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=2
10	E9PUP3	750	929	0.376	0.461	E9PUP3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
11	E9Q3M5	1978	1116	0.894	0.910	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
12	G5EC65	829	1119	0.405	0.411	G5EC65_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
13	G5EDF4	829	1161	0.405	0.396	G5EDF4_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
14	M9PB59	863	1134	0.412	0.414	M9PB59_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
15	M9PB60	861	1126	0.407	0.411	M9PB60_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
16	M9PC92	860	1086	0.403	0.422	M9PC92_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
17	M9PC95	855	1046	0.412	0.447	M9PC95_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
18	M9PCF0	857	1067	0.409	0.436	M9PCF0_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
19	M9PCT2	859	1027	0.399	0.442	M9PCT2_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
20	M9PF01	858	1053	0.405	0.437	M9PF01_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07565 Band_3_cyto	1.1e-104	361.4	Band 3 cytoplasmic domain
2	PF00955 HCO3_cotransp	6.8e-215	726.2	HCO3- transporter family
3	PF00860 Xan_ur_permease	9.5e+02	9.8	Permease family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251768

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354791	0.770	Dynactin subunit 1
2	9606.ENSP00000482968	0.770	Alstrom syndrome protein 1
3	9606.ENSP00000429763	0.726	Protein FAM196A
4	9606.ENSP00000358814	0.714	S-adenosylhomocysteine hydrolase-like protein 1
5	9606.ENSP00000357660	0.712	Clarin-3
6	9606.ENSP00000388550	0.696	RING finger protein 24
7	9606.ENSP00000217173	0.684	RING finger protein 37
8	9606.ENSP00000221200	0.680	BTB/POZ domain-containing protein KCTD9
9	9606.ENSP00000357633	0.653	Glutaredoxin-3
10	9606.ENSP00000369756	0.601	Receptor-type tyrosine-protein phosphatase alpha
11	9606.ENSP00000276440	0.579	Dedicator of cytokinesis protein 5
12	9606.ENSP00000263980	0.563	Sodium/hydrogen exchanger 1
13	9606.ENSP00000377617	0.562	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
14	9606.ENSP00000356587	0.550	Podocin
15	9606.ENSP00000377725	0.531	Zinc finger protein with KRAB and SCAN domains 5
16	9606.ENSP00000481091	0.525	Transcriptional adapter 2-alpha
17	9606.ENSP00000262461	0.523	Solute carrier family 12 member 2
18	9606.ENSP00000352941	0.520	BTB/POZ domain-containing protein KCTD18
19	9606.ENSP00000362105	0.520	Probable U3 small nucleolar RNA-associated protein 11
20	9606.ENSP00000428223	0.519	Ribosomal protein L26 like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008510	1.000	sodium:bicarbonate symporter activity
GO:0005515	0.973	protein binding
GO:0015103	0.614	inorganic anion transmembrane transporter activity
GO:0015297	0.468	antiporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.983	localization
GO:0006810	0.958	transport
GO:0065007	0.889	biological regulation
GO:0006811	0.790	monoatomic ion transport
GO:0009987	0.779	cellular process
GO:0019755	0.663	one-carbon compound transport
GO:0042592	0.440	homeostatic process
GO:0050789	0.360	regulation of biological process
GO:0050794	0.328	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0098590	0.988	plasma membrane region
GO:0045177	0.807	apical part of cell
GO:0005622	0.740	intracellular anatomical structure
GO:0005737	0.561	cytoplasm
GO:0045178	0.440	basal part of cell
GO:0016323	0.387	basolateral plasma membrane
GO:0043231	0.361	intracellular membrane-bounded organelle
GO:0016324	0.316	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28695	1.000	hydrogencarbonate(in) = hydrogencarbonate(out)
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]