StarFunc result for job id Q9BY10

User Input

>input (475 residues)
MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASP
SPRGALEDQQQRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSR
LGLLLKVLLDWPVEVLYGAAALNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLML
GLAGFCGSMASGHLFKQMAGHSGQGLILTACSVSCASFALLYSLLVLKVPESVAKPSQEL
PAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTTIALLFVGAIIYDLAVVGT
VDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTMIMIGMVSFGS
GALLLAFVKETYMFYIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGV
VTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAIIPISIVAYKQVPLSPYGDIIEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BY10	1.000	1.000	2.628E-60	475	1.000	1.000	Q9BY10.pdb.gz	S46A2_HUMAN Solute carrier family 46 member 2 OS=Homo sapiens OX=9606 GN=SLC46A2 PE=2 SV=1
2	AFDB:Q8CA03	0.920	0.913	2.666E-47	479	0.768	0.762	Q8CA03.pdb.gz	S46A2_MOUSE Solute carrier family 46 member 2 OS=Mus musculus OX=10090 GN=Slc46a2 PE=1 SV=2
3	AFDB:Q7Z3Q1	0.723	0.743	3.397E-20	461	0.236	0.243	Q7Z3Q1.pdb.gz	S46A3_HUMAN Lysosomal proton-coupled steroid conjugate and bile acid symporter SLC46A3 OS=Homo sapiens OX=9606 GN=SLC46A3 PE=1 SV=1
4	AFDB:Q96NT5	0.753	0.778	3.918E-18	459	0.213	0.220	Q96NT5.pdb.gz	PCFT_HUMAN Proton-coupled folate transporter OS=Homo sapiens OX=9606 GN=SLC46A1 PE=1 SV=1
5	AFDB:Q05B81	0.726	0.748	4.998E-18	459	0.217	0.224	Q05B81.pdb.gz	PCFT_BOVIN Proton-coupled folate transporter OS=Bos taurus OX=9913 GN=SLC46A1 PE=2 SV=1
6	AFDB:Q5EBA8	0.731	0.755	6.640E-18	459	0.229	0.237	Q5EBA8.pdb.gz	PCFT_RAT Proton-coupled folate transporter OS=Rattus norvegicus OX=10116 GN=Slc46a1 PE=1 SV=1
7	PDB:7bc7A	0.693	0.754	1.281E-17	432	0.194	0.213	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
8	AFDB:F1NJ67	0.765	0.768	2.069E-17	473	0.192	0.192	F1NJ67.pdb.gz	PCFT_CHICK Proton-coupled folate transporter OS=Gallus gallus OX=9031 GN=SLC46A1 PE=1 SV=2
9	AFDB:A1Z7R6	0.693	0.640	1.559E-13	519	0.189	0.173	A1Z7R6.pdb.gz	S46_DROME Probable peptidoglycan muropeptide transporter SLC46 OS=Drosophila melanogaster OX=7227 GN=SLC46 PE=2 SV=1
10	AFDB:Q961H2	0.693	0.654	2.866E-13	507	0.183	0.172	Q961H2.pdb.gz	Q961H2_DROME GH23453p OS=Drosophila melanogaster OX=7227 GN=CG8054 PE=1 SV=1
11	AFDB:O13714	0.730	0.547	1.873E-11	644	0.179	0.132	O13714.pdb.gz	YDZ7_SCHPO Uncharacterized membrane protein C14C4.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC14C4.07 PE=1 SV=1
12	PDB:6s4mA	0.627	0.691	1.028E-7	426	0.145	0.162	6s4mA.pdb.gz
13	PDB:3o7qA	0.541	0.607	6.129E-7	414	0.124	0.143	3o7qA.pdb.gz
14	PDB:6thaA	0.581	0.612	6.383E-7	448	0.128	0.136	6thaA.pdb.gz
15	PDB:4gbyA	0.570	0.570	6.647E-7	475	0.120	0.120	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7wsmA	0.573	0.585	9.577E-7	464	0.143	0.147	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
17	PDB:7zh0A	0.490	0.473	1.690E-6	495	0.128	0.123	7zh0A.pdb.gz
18	PDB:4ybqB	0.495	0.507	2.156E-6	462	0.124	0.128	4ybqB.pdb.gz
19	PDB:7aaqA	0.557	0.546	2.435E-6	487	0.139	0.136	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
20	PDB:7yr5A	0.554	0.660	3.806E-6	385	0.118	0.145	7yr5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CA03	0.0	734	479	0.777	0.770	S46A2_MOUSE Solute carrier family 46 member 2 OS=Mus musculus OX=10090 GN=Slc46a2 PE=1 SV=2
2	Q9BY10	0.0	954	475	1.000	1.000	S46A2_HUMAN Solute carrier family 46 member 2 OS=Homo sapiens OX=9606 GN=SLC46A2 PE=2 SV=1
3	Q7Z3Q1	1.74e-36	142	461	0.219	0.226	S46A3_HUMAN Lysosomal proton-coupled steroid conjugate and bile acid symporter SLC46A3 OS=Homo sapiens OX=9606 GN=SLC46A3 PE=1 SV=1
4	Q6PEM8	5.73e-17	85.5	459	0.229	0.237	PCFT_MOUSE Proton-coupled folate transporter OS=Mus musculus OX=10090 GN=Slc46a1 PE=1 SV=1
5	Q96NT5	4.40e-16	82.8	459	0.221	0.229	PCFT_HUMAN Proton-coupled folate transporter OS=Homo sapiens OX=9606 GN=SLC46A1 PE=1 SV=1
6	Q5EBA8	2.99e-15	80.1	459	0.175	0.181	PCFT_RAT Proton-coupled folate transporter OS=Rattus norvegicus OX=10116 GN=Slc46a1 PE=1 SV=1
7	Q05B81	4.19e-14	76.6	459	0.213	0.220	PCFT_BOVIN Proton-coupled folate transporter OS=Bos taurus OX=9913 GN=SLC46A1 PE=2 SV=1
8	F1NJ67	2.17e-11	68.2	473	0.093	0.093	PCFT_CHICK Proton-coupled folate transporter OS=Gallus gallus OX=9031 GN=SLC46A1 PE=1 SV=2
9	Q961H2	1.79e-05	49.7	507	0.185	0.174	Q961H2_DROME GH23453p OS=Drosophila melanogaster OX=7227 GN=CG8054 PE=1 SV=1
10	A1Z7R6	0.001	43.5	519	0.217	0.198	S46_DROME Probable peptidoglycan muropeptide transporter SLC46 OS=Drosophila melanogaster OX=7227 GN=SLC46 PE=2 SV=1
11	Q5ZEG0	6.2	31.2	228	0.034	0.070	MHZ4_ORYSJ Protein MAO HUZI 4, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=MHZ4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	1.6e-10	52.1	Major Facilitator Superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363345

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370532	0.822	Transcription factor IIIA
2	9606.ENSP00000452552	0.778	Zinc finger protein 37 homolog
3	9606.ENSP00000320347	0.768	Zinc finger protein 3 homolog
4	9606.ENSP00000363382	0.752	Sushi domain containing 1
5	9606.ENSP00000258436	0.750	Major facilitator superfamily domain containing 9
6	9606.ENSP00000238256	0.724	FK506-binding protein 15
7	9606.ENSP00000259392	0.705	Probable low affinity copper uptake protein 2
8	9606.ENSP00000362285	0.680	Equilibrative nucleoside transporter 3
9	9606.ENSP00000356115	0.672	Major facilitator superfamily domain containing 4
10	9606.ENSP00000357840	0.650	Sodium-dependent glucose transporter 1
11	9606.ENSP00000363894	0.640	Nipsnap homolog 3B
12	9606.ENSP00000332646	0.634	Major facilitator superfamily domain-containing protein 10
13	9606.ENSP00000380081	0.621	Equilibrative nucleoside transporter 4
14	9606.ENSP00000359171	0.595	Hippocampus abundant transcript 1
15	9606.ENSP00000364493	0.557	Hippocampus abundant transcript-like 1
16	9606.ENSP00000477563	0.556	Major histocompatibility complex class I-related gene protein
17	9606.ENSP00000373153	0.529	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2
18	9606.ENSP00000249079	0.523	UPF0193 protein EVG1
19	9606.ENSP00000440190	0.511	Tudor domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008514	1.000	organic anion transmembrane transporter activity
GO:0015075	0.999	monoatomic ion transmembrane transporter activity
GO:0022804	0.991	active transmembrane transporter activity
GO:0015291	0.979	secondary active transmembrane transporter activity
GO:0005342	0.969	organic acid transmembrane transporter activity
GO:0015318	0.968	inorganic molecular entity transmembrane transporter activity
GO:0046943	0.949	carboxylic acid transmembrane transporter activity
GO:0005488	0.934	binding
GO:0005515	0.906	protein binding
GO:0090482	0.861	vitamin transmembrane transporter activity
GO:0022853	0.775	active monoatomic ion transmembrane transporter activity
GO:0042887	0.551	amide transmembrane transporter activity
GO:0008324	0.538	monoatomic cation transmembrane transporter activity
GO:0022890	0.527	inorganic cation transmembrane transporter activity
GO:0072349	0.510	modified amino acid transmembrane transporter activity
GO:1901702	0.413	salt transmembrane transporter activity
GO:0015293	0.357	symporter activity
GO:0015294	0.301	solute:monoatomic cation symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0002682	0.990	regulation of immune system process
GO:0048518	0.893	positive regulation of biological process
GO:0048583	0.883	regulation of response to stimulus
GO:0002831	0.822	regulation of response to biotic stimulus
GO:0048522	0.811	positive regulation of cellular process
GO:0032101	0.787	regulation of response to external stimulus
GO:0010646	0.772	regulation of cell communication
GO:0023051	0.771	regulation of signaling
GO:0002684	0.685	positive regulation of immune system process
GO:0050776	0.674	regulation of immune response
GO:0031347	0.641	regulation of defense response
GO:0002833	0.639	positive regulation of response to biotic stimulus
GO:0062207	0.620	regulation of pattern recognition receptor signaling pathway
GO:0045089	0.605	positive regulation of innate immune response
GO:0023056	0.555	positive regulation of signaling
GO:0010647	0.555	positive regulation of cell communication
GO:0009987	0.546	cellular process
GO:0062208	0.544	positive regulation of pattern recognition receptor signaling pathway
GO:0051179	0.309	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0009986	0.964	cell surface
GO:0016020	0.933	membrane
GO:0043226	0.916	organelle
GO:0005622	0.916	intracellular anatomical structure
GO:0043227	0.812	membrane-bounded organelle
GO:0043231	0.788	intracellular membrane-bounded organelle
GO:0071944	0.735	cell periphery
GO:0005886	0.729	plasma membrane
GO:0005737	0.500	cytoplasm
GO:0031090	0.316	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]