StarFunc result for job id Q9BY12

User Input

>input (1400 residues)
MMASFQRSNSHDKVRRIVAEEGRTARNLIAWSVPLESKDDDGKPKCQTGGKSKRTIQGTH
KTTKQSTAVDCKITSSTTGDKHFDKSPTKTRHPRKIDLRARYWAFLFDNLRRAVDEIYVT
CESDQSVVECKEVLMMLDNYVRDFKALIDWIQLQEKLEKTDAQSRPTSLAWEVKKMSPGR
HVIPSPSTDRINVTSNARRSLNFGGSTGTVPAPRLAPTGVSWADKVKAHHTGSTASSEIT
PAQSCPPMTVQKASRKNERKDAEGWETVQRGRPIRSRSTAVMPKVSLATEATRSKDDSDK
ENVCLLPDESIQKGQFVGDGTSNTIESHPKDSLHSCDHPLAEKTQFTVSTLDDVKNSGSI
RDNYVRTSEISAVHIDTECVSVMLQAGTPPLQVNEEKFPAEKARIENEMDPSDISNSMAE
VLAKKEELADRLEKANEEAIASAIAEEEQLTREIEAEENNDINIETDNDSDFSASMGSGS
VSFCGMSMDWNDVLADYEARESWRQNTSWGDIVEEEPARPPGHGIHMHEKLSSPSRKRTI
AESKKKHEEKQMKAQQLREKLREEKTLKLQKLLEREKDVRKWKEELLDQRRRMMEEKLLH
AEFKREVQLQAIVKKAQEEEAKVNEIAFINTLEAQNKRHDVLSKLKEYEQRLNELQEERQ
RRQEEKQARDEAVQERKRALEAERQARVEELLMKRKEQEARIEQQRQEKEKAREDAARER
ARDREERLAALTAAQQEAMEELQKKIQLKHDESIRRHMEQIEQRKEKAAELSSGRHANTD
YAPKLTPYERKKQCSLCNVLISSEVYLFSHVKGRKHQQAVRENTSIQGRELSDEEVEHLS
LKKYIIDIVVESTAPAEALKDGEERQKNKKKAKKIKARMNFRAKEYESLMETKNSGSDSP
YKAKLQRLAKDLLKQVQVQDSGSWANNKVSALDRTLGEITRILEKENVADQIAFQAAGGL
TALEHILQAVVPATNVNTVLRIPPKSLCNAINVYNLTCNNCSENCSDVLFSNKITFLMDL
LIHQLTVYVPDENNTILGRNTNKQVFEGLTTGLLKVSAVVLGCLIANRPDGNCQPATPKI
PTQEMKNKPSQGDPFNNRVQDLISYVVNMGLIDKLCACFLSVQGPVDENPKMAIFLQHAA
GLLHAMCTLCFAVTGRSYSIFDNNRQDPTGLTAALQATDLAGVLHMLYCVLFHGTILDPS
TASPKENYTQNTIQVAIQSLRFFNSFAALHLPAFQSIVGAEGLSLAFRHMASSLLGHCSQ
VSCESLLHEVIVCVGYFTVNHPDNQVIVQSGRHPTVLQKLCQLPFQYFSDPRLIKVLFPS
LIAACYNNHQNKIILEQEMSCVLLATFIQDLAQTPGQAENQPYQPKGKCLGSQDYLELAN
RFPQQAWEEARQFFLKKEKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8VQ70	0.652	0.653	0.000	1398	0.879	0.880	F8VQ70.pdb.gz	F8VQ70_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1
2	AFDB:Q9BY12	1.000	1.000	0.000	1400	1.000	1.000	Q9BY12.pdb.gz	SCAPE_HUMAN S phase cyclin A-associated protein in the endoplasmic reticulum OS=Homo sapiens OX=9606 GN=SCAPER PE=1 SV=2
3	AFDB:Q8BIZ8	0.381	0.583	3.032E-85	905	0.553	0.855	Q8BIZ8.pdb.gz	Q8BIZ8_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1
4	AFDB:O35927	0.193	0.214	7.184E-6	1247	0.109	0.123	O35927.pdb.gz	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
5	AFDB:G5EEQ8	0.090	0.094	9.402E-5	1322	0.101	0.107	G5EEQ8.pdb.gz	G5EEQ8_CAEEL Splicing factor 3B subunit 1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sftb-1 PE=1 SV=1
6	PDB:2z6gA	0.100	0.225	9.726E-4	550	0.038	0.096	2z6gA.pdb.gz
7	PDB:2xwuB	0.101	0.133	1.161E-3	910	0.056	0.087	2xwuB.pdb.gz
8	AFDB:Q5DU05	0.080	0.078	1.917E-3	1446	0.129	0.124	Q5DU05.pdb.gz	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
9	PDB:6n1zA	0.105	0.129	2.258E-3	961	0.056	0.082	6n1zA.pdb.gz
10	AFDB:A1Z7Z9	0.058	0.067	3.728E-3	1134	0.122	0.151	A1Z7Z9.pdb.gz	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
11	AFDB:Q5SZL2	0.058	0.091	4.864E-3	805	0.082	0.143	Q5SZL2.pdb.gz	CE85L_HUMAN Centrosomal protein of 85 kDa-like OS=Homo sapiens OX=9606 GN=CEP85L PE=1 SV=1
12	AFDB:Q9SU08	0.071	0.098	5.085E-3	904	0.106	0.164	Q9SU08.pdb.gz	AUXI1_ARATH Auxilin-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=AUXI1 PE=1 SV=2
13	PDB:7t3rA	0.091	0.064	6.262E-3	2130	0.041	0.027	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
14	PDB:5tbkA	0.172	0.480	7.153E-3	417	0.044	0.146	5tbkA.pdb.gz
15	AFDB:Q9UPV0	0.041	0.040	7.579E-3	1460	0.116	0.111	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
16	PDB:7jq9A	0.117	0.079	8.928E-3	2427	0.049	0.028	7jq9A.pdb.gz
17	PDB:7mvxA	0.116	0.105	1.066E-2	1645	0.044	0.038	7mvxA.pdb.gz
18	PDB:6kwyc	0.094	0.079	1.454E-2	1811	0.043	0.033	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.
19	PDB:4r0zA	0.138	0.307	1.589E-2	557	0.054	0.135	4r0zA.pdb.gz
20	PDB:7t3uA	0.094	0.069	1.589E-2	2020	0.044	0.031	7t3uA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RXS3	0.0	2449	1392	0.881	0.886	B2RXS3_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1
2	F8VQ70	0.0	2441	1398	0.881	0.882	F8VQ70_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1
3	H3BPM0	0.0	1519	747	0.529	0.992	H3BPM0_HUMAN S-phase cyclin A associated protein in the ER (Fragment) OS=Homo sapiens OX=9606 GN=SCAPER PE=1 SV=1
4	H3BS25	0.0	1559	767	0.544	0.992	H3BS25_HUMAN S-phase cyclin A associated protein in the ER (Fragment) OS=Homo sapiens OX=9606 GN=SCAPER PE=1 SV=1
5	Q501L8	0.0	1488	863	0.552	0.896	Q501L8_MOUSE Scaper protein (Fragment) OS=Mus musculus OX=10090 GN=Scaper PE=2 SV=1
6	Q69ZJ3	0.0	2449	1393	0.881	0.885	Q69ZJ3_MOUSE MKIAA1454 protein (Fragment) OS=Mus musculus OX=10090 GN=Scaper PE=2 SV=1
7	Q80VY7	0.0	679	370	0.229	0.868	Q80VY7_MOUSE Scaper protein (Fragment) OS=Mus musculus OX=10090 GN=Scaper PE=2 SV=1
8	Q8BIZ8	0.0	1011	905	0.349	0.539	Q8BIZ8_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1
9	Q8BKW5	0.0	1471	864	0.549	0.889	Q8BKW5_MOUSE U1-type domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Scaper PE=2 SV=1
10	Q8BX16	0.0	923	534	0.328	0.860	Q8BX16_MOUSE S phase cyclin A-associated protein in the endoplasmic reticulum N-terminal domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Scaper PE=2 SV=2
11	Q8C0H1	0.0	929	540	0.331	0.857	Q8C0H1_MOUSE S phase cyclin A-associated protein in the endoplasmic reticulum N-terminal domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Scaper PE=2 SV=1
12	Q9BY12	0.0	2918	1400	1.000	1.000	SCAPE_HUMAN S phase cyclin A-associated protein in the endoplasmic reticulum OS=Homo sapiens OX=9606 GN=SCAPER PE=1 SV=2
13	X2J6U8	1.33e-54	212	1730	0.106	0.086	X2J6U8_DROME Short spindle 3, isoform B OS=Drosophila melanogaster OX=7227 GN=ssp3 PE=4 SV=1
14	Q9VJ35	1.39e-54	212	1732	0.106	0.086	Q9VJ35_DROME LD01527p OS=Drosophila melanogaster OX=7227 GN=ssp3 PE=2 SV=3
15	Q8C1F7	7.36e-21	89.4	57	0.030	0.737	Q8C1F7_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Scaper PE=2 SV=1
16	Q38E96	2.40e-07	58.2	1053	0.024	0.032	Q38E96_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0610 PE=4 SV=1
17	Q0E8J3	8.60e-04	46.6	3640	0.031	0.012	Q0E8J3_DROME Zormin, isoform I OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
18	M9PBJ1	0.001	46.6	3664	0.031	0.012	M9PBJ1_DROME Zormin, isoform J OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
19	M9PE03	0.001	46.6	3536	0.031	0.012	M9PE03_DROME Zormin, isoform E OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
20	Q0E8J4	0.001	46.2	3079	0.031	0.014	Q0E8J4_DROME Zormin, isoform G OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16501 SCAPER_N	1.6e-42	154.7	S phase cyclin A-associated protein in the endoplasmic reticulum
2	PF12874 zf-met	0.03	25.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000454973

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274026	0.908	Cyclin-A2
2	9606.ENSP00000267970	0.712	Tetraspanin-3
3	9606.ENSP00000452796	0.706	Pseudopodium-enriched atypical kinase 1
4	9606.ENSP00000452746	0.652	Proline-serine-threonine phosphatase-interacting protein 1
5	9606.ENSP00000266970	0.641	Cyclin-dependent kinase 2
6	9606.ENSP00000290759	0.620	Insulin gene enhancer protein ISL-2
7	9606.ENSP00000367615	0.604	Adenine phosphoribosyltransferase
8	9606.ENSP00000273598	0.567	Nicolin-1
9	9606.ENSP00000367823	0.513	Protein FAM214B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048232	0.990	male gamete generation
GO:0040007	0.989	growth
GO:0035295	0.989	tube development
GO:0022602	0.989	ovulation cycle process
GO:0008584	0.989	male gonad development
GO:0001541	0.989	ovarian follicle development
GO:0007283	0.919	spermatogenesis
GO:0048589	0.912	developmental growth
GO:0065007	0.412	biological regulation
GO:0050789	0.403	regulation of biological process
GO:0050794	0.373	regulation of cellular process
GO:0009987	0.312	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0061827	0.954	sperm head
GO:0070013	0.917	intracellular organelle lumen
GO:0031981	0.907	nuclear lumen
GO:0005654	0.904	nucleoplasm
GO:0005829	0.753	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]