StarFunc result for job id Q9BY44

User Input

>input (585 residues)
MAPSTPLLTVRGSEGLYMVNGPPHFTESTVFPRESGKNCKVCIFSKDGTLFAWGNGEKVN
IISVTNKGLLHSFDLLKAVCLEFSPKNTVLATWQPYTTSKDGTAGIPNLQLYDVKTGTCL
KSFIQKKMQNWCPSWSEDETLCARNVNNEVHFFENNNFNTIANKLHLQKINDFVLSPGPQ
PYKVAVYVPGSKGAPSFVRLYQYPNFAGPHAALANKSFFKADKVTMLWNKKATAVLVIAS
TDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKAT
IFNLKCDPVFDFGTGPRNAAYYSPHGHILVLAGFGNLRGQMEVWDVKNYKLISKPVASDS
TYFAWCPDGEHILTATCAPRLRVNNGYKIWHYTGSILHKYDVPSNAELWQVSWQPFLDGI
FPAKTITYQAVPSEVPNEEPKVATAYRPPALRNKPITNSKLHEEEPPQNMKPQSGNDKPL
SKTALKNQRKHEAKKAAKQEARSDKSPDLAPTPAPQSTPRNTVSQSISGDPEIDKKIKNL
KKKLKAIEQLKEQAATGKQLEKNQLEKIQKETALLQELEDLELGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BY44	1.000	1.000	0.000	585	1.000	1.000	Q9BY44.pdb.gz	EIF2A_HUMAN Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3
2	PDB:8dysA	0.688	0.980	3.886E-74	409	0.697	0.998	8dysA.pdb.gz
3	AFDB:Q9VNX8	0.735	0.676	1.204E-60	638	0.383	0.351	Q9VNX8.pdb.gz	EIF2A_DROME Eukaryotic translation initiation factor 2A OS=Drosophila melanogaster OX=7227 GN=CG7414 PE=1 SV=1
4	AFDB:Q19052	0.704	0.722	1.218E-57	570	0.359	0.368	Q19052.pdb.gz	EIF2A_CAEEL Eukaryotic translation initiation factor 2A OS=Caenorhabditis elegans OX=6239 GN=eif-2A PE=3 SV=2
5	AFDB:O74965	0.708	0.718	6.774E-54	576	0.342	0.347	O74965.pdb.gz	EIF2A_SCHPO Eukaryotic translation initiation factor 2A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4B4.04 PE=1 SV=1
6	AFDB:Q9CAT3	0.662	0.752	1.279E-45	513	0.301	0.343	Q9CAT3.pdb.gz	Q9CAT3_ARATH Eukaryotic translation initiation factor 2A OS=Arabidopsis thaliana OX=3702 GN=At1g73180 PE=1 SV=1
7	AFDB:P53235	0.650	0.594	1.404E-44	642	0.296	0.269	P53235.pdb.gz	EIF2A_YEAST Eukaryotic translation initiation factor 2A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR054W PE=1 SV=1
8	AFDB:Q57UC1	0.658	0.726	1.325E-32	527	0.195	0.216	Q57UC1.pdb.gz	Q57UC1_TRYB2 Translation initiation factor beta propellor-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.90 PE=4 SV=1
9	AFDB:F4K4D5	0.614	0.493	1.796E-27	738	0.140	0.111	F4K4D5.pdb.gz	F4K4D5_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=TIF3B1 PE=1 SV=1
10	AFDB:X1WET9	0.609	0.527	4.682E-27	681	0.144	0.123	X1WET9.pdb.gz	X1WET9_DANRE Eukaryotic translation initiation factor 3 subunit B OS=Danio rerio OX=7955 GN=eif3b PE=1 SV=1
11	AFDB:P55884	0.592	0.432	7.167E-27	814	0.138	0.100	P55884.pdb.gz	EIF3B_HUMAN Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3
12	PDB:4noxA	0.573	0.713	3.619E-26	460	0.147	0.187	4noxA.pdb.gz
13	PDB:6fyxp	0.570	0.519	9.935E-22	647	0.120	0.108	6fyxp.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
14	PDB:6ybt1	0.571	0.568	1.105E-21	588	0.133	0.133	6ybt1.pdb.gz
15	PDB:7a09B	0.564	0.611	3.703E-16	536	0.137	0.149	7a09B.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
16	PDB:7mq8LR	0.233	0.183	1.059E-14	773	0.103	0.078	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:6lqsB1	0.224	0.177	1.621E-14	806	0.116	0.084	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
18	PDB:5mzhB	0.387	0.514	3.603E-14	415	0.096	0.135	5mzhB.pdb.gz
19	PDB:5wyjBA	0.276	0.224	3.603E-14	755	0.116	0.090	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
20	PDB:5nnzA	0.387	0.615	5.515E-14	335	0.087	0.152	5nnzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GH40	0.0	1061	577	0.908	0.920	A0A8I6GH40_RAT Eukaryotic translation initiation factor 2A OS=Rattus norvegicus OX=10116 GN=Eif2a PE=1 SV=1
2	D3ZUV3	0.0	1080	581	0.923	0.929	D3ZUV3_RAT Eukaryotic translation initiation factor 2A OS=Rattus norvegicus OX=10116 GN=Eif2a PE=3 SV=4
3	Q8BJW6	0.0	1088	581	0.928	0.935	EIF2A_MOUSE Eukaryotic translation initiation factor 2A OS=Mus musculus OX=10090 GN=Eif2a PE=1 SV=2
4	Q9BY44	0.0	1215	585	1.000	1.000	EIF2A_HUMAN Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3
5	Q9VNX8	2.24e-130	397	638	0.395	0.362	EIF2A_DROME Eukaryotic translation initiation factor 2A OS=Drosophila melanogaster OX=7227 GN=CG7414 PE=1 SV=1
6	Q19052	1.88e-110	343	570	0.369	0.379	EIF2A_CAEEL Eukaryotic translation initiation factor 2A OS=Caenorhabditis elegans OX=6239 GN=eif-2A PE=3 SV=2
7	O74965	6.59e-97	308	576	0.356	0.361	EIF2A_SCHPO Eukaryotic translation initiation factor 2A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4B4.04 PE=1 SV=1
8	Q9CAT3	5.11e-76	252	513	0.267	0.304	Q9CAT3_ARATH Eukaryotic translation initiation factor 2A OS=Arabidopsis thaliana OX=3702 GN=At1g73180 PE=1 SV=1
9	P53235	3.55e-58	207	642	0.309	0.282	EIF2A_YEAST Eukaryotic translation initiation factor 2A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR054W PE=1 SV=1
10	Q57UC1	3.35e-29	124	527	0.198	0.220	Q57UC1_TRYB2 Translation initiation factor beta propellor-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.90 PE=4 SV=1
11	X1WET9	2.72e-20	97.4	681	0.174	0.150	X1WET9_DANRE Eukaryotic translation initiation factor 3 subunit B OS=Danio rerio OX=7955 GN=eif3b PE=1 SV=1
12	P55884	1.22e-19	95.5	814	0.166	0.119	EIF3B_HUMAN Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3
13	Q8JZQ9	1.66e-19	95.1	803	0.161	0.117	EIF3B_MOUSE Eukaryotic translation initiation factor 3 subunit B OS=Mus musculus OX=10090 GN=Eif3b PE=1 SV=1
14	Q4G061	1.73e-19	95.1	797	0.161	0.118	EIF3B_RAT Eukaryotic translation initiation factor 3 subunit B OS=Rattus norvegicus OX=10116 GN=Eif3b PE=1 SV=1
15	Q9C5Z1	4.02e-17	87.4	712	0.152	0.125	EIF3B_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=TIF3B1 PE=1 SV=1
16	F4K4D5	4.69e-17	87.4	738	0.152	0.121	F4K4D5_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=TIF3B1 PE=1 SV=1
17	Q8GUM1	4.86e-16	84.0	714	0.152	0.125	Q8GUM1_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=EIF3B-2 PE=1 SV=1
18	Q9M4T6	1.01e-12	73.6	716	0.125	0.102	Q9M4T6_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 PE=1 SV=1
19	Q0E940	5.90e-10	64.7	690	0.121	0.103	EIF3B_DROME Eukaryotic translation initiation factor 3 subunit B OS=Drosophila melanogaster OX=7227 GN=eIF3b PE=1 SV=1
20	Q5BGH1	8.26e-07	54.3	738	0.132	0.104	EIF3B_EMENI Eukaryotic translation initiation factor 3 subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=prt1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08662 eIF2A	3.9e-74	260.3	Eukaryotic translation initiation factor eIF2A
2	PF19427 Insc_C	9.3e+02	9.6	Protein inscuteable C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417229

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256383	0.995	Eukaryotic translation initiation factor 2 subunit 1
2	9606.ENSP00000364119	0.994	Eukaryotic translation initiation factor 2 subunit 2
3	9606.ENSP00000253039	0.986	Eukaryotic translation initiation factor 2 subunit 3
4	9606.ENSP00000233057	0.970	Interferon-induced, double-stranded RNA-activated protein kinase
5	9606.ENSP00000354125	0.948	Eukaryotic translation initiation factor 3 subunit B
6	9606.ENSP00000445077	0.928	Putative eukaryotic translation initiation factor 2 subunit 3-like protein
7	9606.ENSP00000264335	0.915	14-3-3 protein epsilon
8	9606.ENSP00000354394	0.903	Signal transducer and activator of transcription 1-alpha/beta
9	9606.ENSP00000221930	0.900	Transforming growth factor beta-1
10	9606.ENSP00000238682	0.900	Transforming growth factor beta-3
11	9606.ENSP00000351905	0.900	TGF-beta receptor type-2
12	9606.ENSP00000364133	0.900	TGF-beta receptor type-1
13	9606.ENSP00000289371	0.892	Eukaryotic translation initiation factor 5B
14	9606.ENSP00000369757	0.868	40S ribosomal protein S6
15	9606.ENSP00000220849	0.864	Eukaryotic translation initiation factor 3 subunit E
16	9606.ENSP00000358140	0.839	Eukaryotic translation initiation factor 3 subunit A
17	9606.ENSP00000216190	0.830	Eukaryotic translation initiation factor 3 subunit D
18	9606.ENSP00000253108	0.828	Eukaryotic translation initiation factor 3 subunit G
19	9606.ENSP00000436049	0.813	Eukaryotic translation initiation factor 3 subunit M
20	9606.ENSP00000429931	0.812	Eukaryotic translation initiation factor 3 subunit H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043021	1.000	ribonucleoprotein complex binding
GO:0045296	1.000	cadherin binding
GO:0000049	1.000	tRNA binding
GO:0003743	1.000	translation initiation factor activity
GO:0043022	0.994	ribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0010556	0.940	regulation of macromolecule biosynthetic process
GO:0031326	0.940	regulation of cellular biosynthetic process
GO:0034248	0.922	regulation of amide metabolic process
GO:0010468	0.922	regulation of gene expression
GO:2000112	0.915	regulation of cellular macromolecule biosynthetic process
GO:0080090	0.885	regulation of primary metabolic process
GO:0051246	0.853	regulation of protein metabolic process
GO:0071704	0.848	organic substance metabolic process
GO:0044238	0.837	primary metabolic process
GO:0044237	0.816	cellular metabolic process
GO:0006807	0.815	nitrogen compound metabolic process
GO:0043170	0.777	macromolecule metabolic process
GO:0010608	0.770	post-transcriptional regulation of gene expression
GO:0071840	0.741	cellular component organization or biogenesis
GO:0050896	0.728	response to stimulus
GO:0006417	0.714	regulation of translation
GO:1901564	0.712	organonitrogen compound metabolic process
GO:0044085	0.588	cellular component biogenesis
GO:0019538	0.572	protein metabolic process
GO:0016043	0.564	cellular component organization
GO:0034641	0.490	cellular nitrogen compound metabolic process
GO:0044260	0.470	cellular macromolecule metabolic process
GO:0048518	0.434	positive regulation of biological process
GO:0006950	0.432	response to stress
GO:0044249	0.426	cellular biosynthetic process
GO:0010467	0.417	gene expression
GO:1901576	0.411	organic substance biosynthetic process
GO:0048522	0.358	positive regulation of cellular process
GO:0043043	0.355	peptide biosynthetic process
GO:0022607	0.346	cellular component assembly
GO:0006412	0.345	translation
GO:0048519	0.329	negative regulation of biological process
GO:0022613	0.324	ribonucleoprotein complex biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0032991	0.982	protein-containing complex
GO:0005576	0.774	extracellular region
GO:0005615	0.736	extracellular space
GO:0043227	0.645	membrane-bounded organelle
GO:0070013	0.549	intracellular organelle lumen
GO:0031981	0.542	nuclear lumen
GO:0016020	0.509	membrane
GO:0005850	0.387	eukaryotic translation initiation factor 2 complex
GO:0005829	0.371	cytosol
GO:0005654	0.302	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]