StarFunc result for job id Q9BY66

User Input

>input (1539 residues)
MEPGCDEFLPPPECPVFEPSWAEFQDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEV
DNFRFTPRVQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERKILDLYSLSKIVI
EEGGYEAICKDRRWARVAQRLHYPPGKNIGSLLRSHYERIIYPYEMFQSGANHVQCNTHP
FDNEVKDKEYKPHSIPLRQSVQPSKFSSYSRRAKRLQPDPEPTEEDIEKHPELKKLQIYG
PGPKMMGLGLMAKDKDKTVHKKVTCPPTVTVKDEQSGGGNVSSTLLKQHLSLEPCTKTTM
QLRKNHSSAQFIDSYICQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPK
CILAECKQPPEAFGFEQATQEYSLQSFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLVS
SIEEDVTVEYGADIHSKEFGSGFPVSNSKQNLSPEEKEYATSGWNLNVMPVLDQSVLCHI
NADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMK
MLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYN
FAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAAFPETLDLNLAVAVHKEM
FIMVQEERRLRKALLEKGVTEAEREAFELLPDDERQCIKCKTTCFLSALACYDCPDGLVC
LSHINDLCKCSSSRQYLRYRYTLDELPTMLHKLKIRAESFDTWANKVRVALEVEDGRKRS
FEELRALESEARERRFPNSELLQRLKNCLSEVEACIAQVLGLVSGQVARMDTPQLTLTEL
RVLLEQMGSLPCAMHQIGDVKDVLEQVEAYQAEAREALATLPSSPGLLRSLLERGQQLGV
EVPEAHQLQQQVEQAQWLDEVKQALAPSAHRGSLVIMQGLLVMGAKIASSPSVDKARAEL
QELLTIAERWEEKAHFCLEARQKHPPATLEAIIRETENIPVHLPNIQALKEALTKAQAWI
ADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHSWREKASKTFLKKN
SCYTLLEVLCPCADAGSDSTKRSRWMEKALGLYQCDTELLGLSAQDLRDPGSVIVAFKEG
EQKEKEGILQLRRTNSAKPSPLAPSLMASSPTSICVCGQVPAGVGVLQCDLCQDWFHGQC
VSVPHLLTSPKPSLTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLPVRLP
EGEALQCLTERAIGWQDRARKALASEDVTALLRQLAELRQQLQAKPRPEEASVYTSATAC
DPIREGSGNNISKVQGLLENGDSVTSPENMAPGKGSDLELLSSLLPQLTGPVLELPEAIR
APLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLDRIRTLLELEKFEHQGSRTRSRALE
RRRRRQKVDQGRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDH
SPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0S6L0	0.490	0.479	0.000	1578	0.602	0.587	B0S6L0.pdb.gz	B0S6L0_DANRE [histone H3]-trimethyl-L-lysine(4) demethylase OS=Danio rerio OX=7955 GN=im:7158173 PE=1 SV=1
2	AFDB:P41229	0.694	0.686	0.000	1560	0.860	0.849	P41229.pdb.gz	KDM5C_HUMAN Lysine-specific demethylase 5C OS=Homo sapiens OX=9606 GN=KDM5C PE=1 SV=2
3	AFDB:Q62240	0.629	0.626	0.000	1548	0.805	0.800	Q62240.pdb.gz	KDM5D_MOUSE Lysine-specific demethylase 5D OS=Mus musculus OX=10090 GN=Kdm5d PE=2 SV=2
4	AFDB:Q80Y84	0.513	0.511	0.000	1544	0.454	0.453	Q80Y84.pdb.gz	KDM5B_MOUSE Lysine-specific demethylase 5B OS=Mus musculus OX=10090 GN=Kdm5b PE=1 SV=1
5	AFDB:Q9BY66	1.000	1.000	0.000	1539	1.000	1.000	Q9BY66.pdb.gz	KDM5D_HUMAN Lysine-specific demethylase 5D OS=Homo sapiens OX=9606 GN=KDM5D PE=1 SV=2
6	AFDB:Q9VMJ7	0.486	0.411	0.000	1838	0.413	0.345	Q9VMJ7.pdb.gz	KDM5_DROME Lysine-specific demethylase 5 OS=Drosophila melanogaster OX=7227 GN=Kdm5 PE=1 SV=1
7	AFDB:Q23541	0.416	0.432	1.141E-76	1477	0.256	0.267	Q23541.pdb.gz	KDM5_CAEEL Lysine-specific demethylase rbr-2 OS=Caenorhabditis elegans OX=6239 GN=rbr-2 PE=1 SV=2
8	AFDB:F4I240	0.245	0.310	9.384E-46	1208	0.187	0.238	F4I240.pdb.gz	JMJ17_ARATH Lysine-specific demethylase JMJ17 OS=Arabidopsis thaliana OX=3702 GN=JMJ17 PE=1 SV=1
9	AFDB:Q9UT79	0.357	0.347	7.238E-44	1588	0.166	0.161	Q9UT79.pdb.gz	MSC1_SCHPO Multicopy suppressor of chk1 protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msc1 PE=3 SV=1
10	AFDB:Q9US53	0.327	0.671	2.320E-43	715	0.142	0.306	Q9US53.pdb.gz	JMJ2_SCHPO Jumonji/ARID domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=jmj2 PE=4 SV=1
11	PDB:3al5B	0.057	0.253	3.781E-3	311	0.008	0.039	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
12	PDB:3al5C	0.064	0.290	1.159E-2	284	0.010	0.053	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
13	PDB:4b7eA	0.089	0.318	1.267E-2	349	0.014	0.060	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
14	PDB:4cclB	0.069	0.237	1.813E-2	372	0.015	0.062	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
15	PDB:7cl4F	0.052	0.233	2.074E-2	285	0.014	0.077	7cl4F.pdb.gz
16	PDB:4qszA	0.088	0.180	2.269E-2	686	0.016	0.035	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
17	PDB:5zmdG	0.069	0.207	2.269E-2	403	0.022	0.084	5zmdG.pdb.gz	Structural insights into FTO's catalytic mechanism for the demethylation of multiple RNA substrates.
18	PDB:7yxgA	0.087	0.350	2.714E-2	313	0.014	0.067	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
19	PDB:5ybnA	0.067	0.261	3.714E-2	296	0.018	0.095	5ybnA.pdb.gz	Structure function and engineering of multifunctional non-heme iron dependent oxygenases in fungal meroterpenoid biosynthesis.
20	PDB:5nfnB	0.060	0.250	4.062E-2	318	0.015	0.072	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096MJZ8	1478	1635	0.481	0.453	A0A096MJZ8_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=1
2	A0A0G2JTU9	1472	1553	0.481	0.476	A0A0G2JTU9_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=2
3	A0A0G2JW30	1056	630	0.327	0.800	A0A0G2JW30_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=3 SV=2
4	A0A0G2K1H0	2582	1554	0.829	0.821	A0A0G2K1H0_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=1
5	A0A0G2K3N6	1330	1544	0.452	0.451	A0A0G2K3N6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
6	A0A0G2K454	1476	1634	0.481	0.453	A0A0G2K454_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=1
7	A0A0G2K6G9	1335	1517	0.453	0.459	A0A0G2K6G9_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
8	A0A0G2K897	2459	1510	0.803	0.819	A0A0G2K897_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=2
9	A0A384MR42	3178	1539	1.000	1.000	A0A384MR42_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=SMCY PE=2 SV=1
10	A0A3B3IS40	1311	1539	0.458	0.458	A0A3B3IS40_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
11	A0A3B3ISE6	1237	1472	0.439	0.459	A0A3B3ISE6_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
12	A0A3B3IT25	1328	1517	0.460	0.467	A0A3B3IT25_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
13	A0A3B3ITA8	1038	1499	0.365	0.374	A0A3B3ITA8_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
14	A0A3B3ITE7	1327	1505	0.460	0.470	A0A3B3ITE7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
15	A0A3B3ITJ7	1236	1503	0.439	0.449	A0A3B3ITJ7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
16	A0A8I5ZPK6	1476	1636	0.481	0.452	A0A8I5ZPK6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=3 SV=1
17	A6N6J7	2608	1440	0.828	0.885	A6N6J7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=JARID1C PE=2 SV=1
18	B0S6L0	1843	1578	0.605	0.590	B0S6L0_DANRE [histone H3]-trimethyl-L-lysine(4) demethylase OS=Danio rerio OX=7955 GN=im:7158173 PE=1 SV=1
19	B3KV94	1101	1275	0.396	0.478	B3KV94_HUMAN Jumonji, AT rich interactive domain 1B (RBP2-like), isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
20	E9PFH2	3037	1476	0.959	1.000	E9PFH2_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase (Fragment) OS=Homo sapiens OX=9606 GN=KDM5D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	3e-13	61.6	ARID/BRIGHT DNA binding domain
2	PF02373 JmjC	6.2e-40	147.6	JmjC domain, hydroxylase
3	PF02375 JmjN	7.4e-13	59.4	jmjN domain
4	PF00628 PHD	1.6e-12	58.4	PHD-finger
5	PF08429 PLU-1	3.5e-85	297.8	PLU-1-like protein
6	PF02928 zf-C5HC2	8.5e-12	56.5	C5HC2 zinc finger
7	PF16744 zf-RING_15	96	14.5	KIAA1045 RING finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000038793

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000038766	0.827	USP9Y
2	9598.ENSPTRP00000060659	0.805	Histone deacetylase
3	9598.ENSPTRP00000058594	0.804	Male-specific histone demethylase that catalyzes trimethylated 'Lys-27' (H3K27me3) demethylation in histone H3. Has relatively low lysine demethylase activity.
4	9598.ENSPTRP00000037292	0.794	Uncharacterized protein
5	9598.ENSPTRP00000038749	0.794	Zinc finger Y-chromosomal protein
6	9598.ENSPTRP00000038797	0.773	Eukaryotic translation initiation factor 1A, Y-chromosomal
7	9598.ENSPTRP00000038771	0.758	ATP-dependent RNA helicase DDX3Y
8	9598.ENSPTRP00000023370	0.755	Uncharacterized protein
9	9598.ENSPTRP00000016989	0.744	ATP synthase subunit alpha, mitochondrial
10	9598.ENSPTRP00000044643	0.744	ATP synthase subunit gamma
11	9598.ENSPTRP00000017323	0.743	ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
12	9598.ENSPTRP00000023882	0.742	ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
13	9598.ENSPTRP00000044421	0.727	Ash2 (Absent, small, or homeotic)-like
14	9598.ENSPTRP00000050361	0.727	Euchromatic histone-lysine N-methyltransferase 2
15	9598.ENSPTRP00000038748	0.719	Pan troglodytes ribosomal protein S4, Y-linked 1 (RPS4Y1), mRNA
16	9598.ENSPTRP00000061399	0.716	ATP synthase subunit a
17	9598.ENSPTRP00000061235	0.703	Pan troglodytes protein kinase, X-linked (PRKX), mRNA
18	9598.ENSPTRP00000001899	0.691	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
19	9598.ENSPTRP00000052457	0.691	Uncharacterized protein
20	9598.ENSPTRP00000037088	0.687	Transducin beta like 1, Y-linked

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.992	protein binding
GO:0032453	0.992	histone H3K4 demethylase activity
GO:0061629	0.819	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.714	nuclear receptor binding
GO:0050681	0.694	nuclear androgen receptor binding
GO:0003677	0.544	DNA binding
GO:0008270	0.359	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0019222	0.791	regulation of metabolic process
GO:0060255	0.744	regulation of macromolecule metabolic process
GO:0050896	0.723	response to stimulus
GO:0009987	0.722	cellular process
GO:0031323	0.641	regulation of cellular metabolic process
GO:0010468	0.640	regulation of gene expression
GO:0080090	0.638	regulation of primary metabolic process
GO:0051171	0.638	regulation of nitrogen compound metabolic process
GO:0010556	0.625	regulation of macromolecule biosynthetic process
GO:0031326	0.624	regulation of cellular biosynthetic process
GO:0071704	0.601	organic substance metabolic process
GO:0019219	0.577	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.567	regulation of DNA-templated transcription
GO:0044238	0.558	primary metabolic process
GO:0006807	0.547	nitrogen compound metabolic process
GO:1901564	0.517	organonitrogen compound metabolic process
GO:0048519	0.459	negative regulation of biological process
GO:0048523	0.436	negative regulation of cellular process
GO:0010605	0.395	negative regulation of macromolecule metabolic process
GO:0043170	0.394	macromolecule metabolic process
GO:0031324	0.394	negative regulation of cellular metabolic process
GO:0009890	0.386	negative regulation of biosynthetic process
GO:0031327	0.384	negative regulation of cellular biosynthetic process
GO:0010558	0.380	negative regulation of macromolecule biosynthetic process
GO:0051172	0.366	negative regulation of nitrogen compound metabolic process
GO:0048583	0.364	regulation of response to stimulus
GO:0032501	0.348	multicellular organismal process
GO:0019538	0.326	protein metabolic process
GO:0042221	0.323	response to chemical
GO:1903507	0.321	negative regulation of nucleic acid-templated transcription
GO:0023051	0.316	regulation of signaling
GO:0010646	0.316	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0001650	0.975	fibrillar center
GO:0032991	0.917	protein-containing complex
GO:0005737	0.431	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]