StarFunc result for job id Q9BY67

User Input

>input (442 residues)
MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVA
TISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEG
RYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWF
KGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQ
YKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFI
NNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTTILTIITD
SRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADA
DTAIINAEGGQNNSEEKKEYFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R5M8	0.714	0.693	2.588E-69	456	0.986	0.956	Q8R5M8.pdb.gz	CADM1_MOUSE Cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Cadm1 PE=1 SV=2
2	AFDB:Q6AYP5	0.691	0.643	2.104E-64	476	0.907	0.842	Q6AYP5.pdb.gz	CADM1_RAT Cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Cadm1 PE=1 SV=1
3	AFDB:Q1WIM2	0.621	0.631	1.504E-39	435	0.434	0.441	Q1WIM2.pdb.gz	CADM2_RAT Cell adhesion molecule 2 OS=Rattus norvegicus OX=10116 GN=Cadm2 PE=1 SV=2
4	AFDB:Q8NFZ8	0.567	0.635	5.771E-39	388	0.360	0.410	Q8NFZ8.pdb.gz	CADM4_HUMAN Cell adhesion molecule 4 OS=Homo sapiens OX=9606 GN=CADM4 PE=1 SV=1
5	AFDB:B0CLV6	0.629	0.660	1.280E-38	420	0.378	0.398	B0CLV6.pdb.gz	B0CLV6_DANRE Cell adhesion molecule 3 OS=Danio rerio OX=7955 GN=zgc:136589 PE=1 SV=1
6	AFDB:Q6PFK4	0.581	0.630	1.624E-37	405	0.391	0.427	Q6PFK4.pdb.gz	Q6PFK4_DANRE Cell adhesion molecule 2a OS=Danio rerio OX=7955 GN=zgc:66339 PE=1 SV=1
7	AFDB:B0CLV3	0.526	0.555	3.786E-37	413	0.342	0.366	B0CLV3.pdb.gz	B0CLV3_DANRE Cell adhesion molecule 4 OS=Danio rerio OX=7955 GN=zgc:101704 PE=1 SV=1
8	AFDB:F1QF23	0.504	0.556	4.347E-36	391	0.339	0.384	F1QF23.pdb.gz
9	AFDB:Q8N126	0.613	0.678	4.933E-34	398	0.351	0.389	Q8N126.pdb.gz	CADM3_HUMAN Cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CADM3 PE=1 SV=1
10	AFDB:Q9JLB9	0.570	0.467	1.010E-26	549	0.240	0.193	Q9JLB9.pdb.gz	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
11	PDB:6dldD	0.447	0.692	2.048E-16	269	0.131	0.216	6dldD.pdb.gz
12	PDB:6dlfA	0.407	0.718	5.828E-16	236	0.143	0.267	6dlfA.pdb.gz
13	PDB:5oj2B	0.276	0.187	2.913E-12	692	0.124	0.079	5oj2B.pdb.gz
14	PDB:2rcjC	0.237	0.210	2.136E-11	523	0.127	0.107	2rcjC.pdb.gz
15	PDB:5c7kF	0.229	0.400	7.420E-11	212	0.093	0.193	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
16	PDB:1e07A	0.299	0.222	1.000E-10	642	0.127	0.087	1e07A.pdb.gz
17	PDB:4ydvL	0.216	0.399	1.912E-10	206	0.095	0.204	4ydvL.pdb.gz	Human Non-neutralizing HIV-1 Envelope Monoclonal Antibodies Limit the Number of Founder Viruses during SHIV Mucosal Infection in Rhesus Macaques.
18	PDB:6b9yA	0.233	0.410	1.912E-10	214	0.086	0.178	6b9yA.pdb.gz	Template-Catalyzed, Disulfide Conjugation of Monoclonal Antibodies Using a Natural Amino Acid Tag.
19	PDB:1gafL	0.218	0.385	2.333E-10	214	0.072	0.150	1gafL.pdb.gz	The immunological evolution of catalysis.
20	PDB:6dcvA	0.231	0.400	2.333E-10	220	0.088	0.177	6dcvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6AYP5	0.0	876	476	0.980	0.910	CADM1_RAT Cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Cadm1 PE=1 SV=1
2	Q8R5M8	0.0	895	456	0.986	0.956	CADM1_MOUSE Cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Cadm1 PE=1 SV=2
3	Q9BY67	0.0	919	442	1.000	1.000	CADM1_HUMAN Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1 PE=1 SV=2
4	Q8BLQ9	2.40e-113	342	435	0.441	0.448	CADM2_MOUSE Cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Cadm2 PE=1 SV=2
5	Q1WIM2	7.33e-113	340	435	0.439	0.446	CADM2_RAT Cell adhesion molecule 2 OS=Rattus norvegicus OX=10116 GN=Cadm2 PE=1 SV=2
6	Q8N3J6	1.65e-110	334	435	0.437	0.444	CADM2_HUMAN Cell adhesion molecule 2 OS=Homo sapiens OX=9606 GN=CADM2 PE=2 SV=1
7	Q6PFK4	1.87e-99	305	405	0.398	0.435	Q6PFK4_DANRE Cell adhesion molecule 2a OS=Danio rerio OX=7955 GN=zgc:66339 PE=1 SV=1
8	Q8R464	4.08e-93	288	388	0.339	0.387	CADM4_MOUSE Cell adhesion molecule 4 OS=Mus musculus OX=10090 GN=Cadm4 PE=1 SV=1
9	Q8NFZ8	6.56e-93	287	388	0.337	0.384	CADM4_HUMAN Cell adhesion molecule 4 OS=Homo sapiens OX=9606 GN=CADM4 PE=1 SV=1
10	B0CLV6	2.71e-89	279	420	0.362	0.381	B0CLV6_DANRE Cell adhesion molecule 3 OS=Danio rerio OX=7955 GN=zgc:136589 PE=1 SV=1
11	Q5U3R8	2.13e-85	268	389	0.335	0.380	Q5U3R8_DANRE Cadm4 protein OS=Danio rerio OX=7955 GN=zgc:101704 PE=2 SV=1
12	B0CLV3	2.93e-84	266	413	0.333	0.356	B0CLV3_DANRE Cell adhesion molecule 4 OS=Danio rerio OX=7955 GN=zgc:101704 PE=1 SV=1
13	Q8N126	4.98e-79	252	398	0.346	0.384	CADM3_HUMAN Cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CADM3 PE=1 SV=1
14	Q99N28	5.23e-79	252	396	0.353	0.394	CADM3_MOUSE Cell adhesion molecule 3 OS=Mus musculus OX=10090 GN=Cadm3 PE=1 SV=1
15	A0A8I6APZ5	3.30e-22	100	438	0.183	0.185	A0A8I6APZ5_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
16	Q9JLB9	1.23e-21	99.8	549	0.158	0.128	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
17	D4A5C0	4.58e-21	97.8	528	0.195	0.163	D4A5C0_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=1 SV=2
18	A0A8I5ZU75	5.96e-21	97.4	549	0.199	0.160	A0A8I5ZU75_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
19	Q9NQS3	6.77e-21	97.4	549	0.197	0.158	NECT3_HUMAN Nectin-3 OS=Homo sapiens OX=9606 GN=NECTIN3 PE=1 SV=1
20	Q9V4Y0	1.37e-19	94.4	1482	0.192	0.057	Q9V4Y0_DROME SNS OS=Drosophila melanogaster OX=7227 GN=sns PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	59	14.9	Adenovirus E3 region protein CR1
2	PF07654 C1-set	3.4	19.4	Immunoglobulin C1-set domain
3	PF05790 C2-set	3.5e+02	12.8	Immunoglobulin C2-set domain
4	PF08205 C2-set_2	2.8e-09	48.2	CD80-like C2-set immunoglobulin domain
5	PF07679 I-set	3.3e-21	86.5	Immunoglobulin I-set domain
6	PF00047 ig	1.7e-16	71.5	Immunoglobulin domain
7	PF13895 Ig_2	7.9e-23	91.9	Immunoglobulin domain
8	PF13927 Ig_3	3.9e-24	96.3	Immunoglobulin domain
9	PF16680 Ig_4	2	20.4	T-cell surface glycoprotein CD3 delta chain
10	PF17736 Ig_C17orf99	2.6	19.5	C17orf99 Ig domain
11	PF16706 Izumo-Ig	2.1	19.6	Izumo-like Immunoglobulin domain
12	PF01034 Syndecan	1.1e+02	14.2	Syndecan domain
13	PF07686 V-set	2.1e-13	61.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329797

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343158	0.998	Band 4.1-like protein 3
2	9606.ENSP00000227348	0.954	Cytotoxic and regulatory T-cell molecule
3	9606.ENSP00000267101	0.952	Receptor tyrosine-protein kinase erbB-3
4	9606.ENSP00000367408	0.939	Peripheral plasma membrane protein CASK
5	9606.ENSP00000381425	0.930	MAGUK p55 subfamily member 3
6	9606.ENSP00000394794	0.926	Tyrosine-protein phosphatase non-receptor type 13
7	9606.ENSP00000222644	0.923	MAGUK p55 subfamily member 6
8	9606.ENSP00000348461	0.905	Ras-related C3 botulinum toxin substrate 1
9	9606.ENSP00000260130	0.871	Syntenin-1
10	9606.ENSP00000418070	0.865	Nectin-3
11	9606.ENSP00000471242	0.843	FERM, ARHGEF and pleckstrin domain-containing protein 1
12	9606.ENSP00000312002	0.842	Hepatitis A virus cellular receptor 2
13	9606.ENSP00000357106	0.836	Cell adhesion molecule 3
14	9606.ENSP00000286827	0.833	T-lymphoma invasion and metastasis-inducing protein 1
15	9606.ENSP00000338481	0.804	Band 4.1-like protein 2
16	9606.ENSP00000337168	0.796	Band 4.1-like protein 1
17	9606.ENSP00000381098	0.777	Glutamate receptor-interacting protein 1
18	9606.ENSP00000264832	0.768	Intercellular adhesion molecule 1
19	9606.ENSP00000439807	0.736	Multiple PDZ domain protein
20	9606.ENSP00000480489	0.707	PDZ domain-containing protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.843	signaling receptor binding
GO:0042802	0.658	identical protein binding
GO:0050839	0.416	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0048518	0.991	positive regulation of biological process
GO:0031347	0.990	regulation of defense response
GO:0032101	0.986	regulation of response to external stimulus
GO:0050776	0.986	regulation of immune response
GO:0031341	0.985	regulation of cell killing
GO:0002697	0.985	regulation of immune effector process
GO:0002699	0.983	positive regulation of immune effector process
GO:0042269	0.983	regulation of natural killer cell mediated cytotoxicity
GO:0050896	0.979	response to stimulus
GO:0002705	0.971	positive regulation of leukocyte mediated immunity
GO:0048522	0.967	positive regulation of cellular process
GO:0019222	0.960	regulation of metabolic process
GO:0048856	0.937	anatomical structure development
GO:0032501	0.935	multicellular organismal process
GO:0060255	0.932	regulation of macromolecule metabolic process
GO:0002708	0.927	positive regulation of lymphocyte mediated immunity
GO:0001912	0.926	positive regulation of leukocyte mediated cytotoxicity
GO:0002717	0.922	positive regulation of natural killer cell mediated immunity
GO:0007275	0.900	multicellular organism development
GO:0009893	0.841	positive regulation of metabolic process
GO:0010468	0.829	regulation of gene expression
GO:0007155	0.798	cell adhesion
GO:0098609	0.780	cell-cell adhesion
GO:0045954	0.759	positive regulation of natural killer cell mediated cytotoxicity
GO:0048731	0.740	system development
GO:0010604	0.678	positive regulation of macromolecule metabolic process
GO:0048519	0.670	negative regulation of biological process
GO:0023051	0.649	regulation of signaling
GO:0008037	0.641	cell recognition
GO:0009966	0.641	regulation of signal transduction
GO:0051239	0.611	regulation of multicellular organismal process
GO:0031323	0.557	regulation of cellular metabolic process
GO:0080090	0.553	regulation of primary metabolic process
GO:0051171	0.548	regulation of nitrogen compound metabolic process
GO:0048523	0.527	negative regulation of cellular process
GO:0007399	0.519	nervous system development
GO:0051716	0.510	cellular response to stimulus
GO:0023052	0.502	signaling
GO:0007154	0.462	cell communication
GO:0098742	0.447	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0007165	0.344	signal transduction
GO:0071840	0.335	cellular component organization or biogenesis
GO:0051246	0.325	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.911	organelle
GO:0005622	0.882	intracellular anatomical structure
GO:0043227	0.824	membrane-bounded organelle
GO:0043229	0.790	intracellular organelle
GO:0005737	0.785	cytoplasm
GO:0043231	0.644	intracellular membrane-bounded organelle
GO:0030054	0.590	cell junction
GO:0031982	0.531	vesicle
GO:0042995	0.512	cell projection
GO:0120025	0.504	plasma membrane bounded cell projection
GO:0012505	0.444	endomembrane system
GO:0043005	0.375	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]