StarFunc result for job id Q9BY76

User Input

>input (406 residues)
MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAE
RTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLF
HKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSR
LHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRP
WEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAY
SLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLN
GQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BY76	1.000	1.000	4.364E-74	406	1.000	1.000	Q9BY76.pdb.gz	ANGL4_HUMAN Angiopoietin-related protein 4 OS=Homo sapiens OX=9606 GN=ANGPTL4 PE=1 SV=2
2	AFDB:Q9Z1P8	0.577	0.571	2.484E-54	410	0.761	0.754	Q9Z1P8.pdb.gz	ANGL4_MOUSE Angiopoietin-related protein 4 OS=Mus musculus OX=10090 GN=Angptl4 PE=1 SV=1
3	AFDB:F1QYL5	0.481	0.420	2.035E-27	466	0.318	0.277	F1QYL5.pdb.gz
4	AFDB:Q9R182	0.480	0.431	7.466E-27	455	0.318	0.284	Q9R182.pdb.gz	ANGL3_MOUSE Angiopoietin-related protein 3 OS=Mus musculus OX=10090 GN=Angptl3 PE=1 SV=1
5	AFDB:Q9Y5C1	0.480	0.426	1.064E-26	460	0.325	0.287	Q9Y5C1.pdb.gz	ANGL3_HUMAN Angiopoietin-related protein 3 OS=Homo sapiens OX=9606 GN=ANGPTL3 PE=1 SV=1
6	AFDB:B1B565	0.482	0.424	1.432E-25	464	0.333	0.291	B1B565.pdb.gz	B1B565_CHICK Angiopoietin-like protein 3 OS=Gallus gallus OX=9031 PE=2 SV=1
7	AFDB:F7FHP0	0.472	0.424	5.911E-25	455	0.318	0.284	F7FHP0.pdb.gz	F7FHP0_RAT Angiopoietin-like 3 OS=Rattus norvegicus OX=10116 GN=Angptl3 PE=4 SV=1
8	AFDB:Q9WVH6	0.485	0.390	8.951E-24	509	0.278	0.222	Q9WVH6.pdb.gz	ANGP4_MOUSE Angiopoietin-4 OS=Mus musculus OX=10090 GN=Angpt4 PE=1 SV=1
9	AFDB:O08538	0.468	0.384	4.680E-23	498	0.271	0.221	O08538.pdb.gz	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
10	AFDB:Q1LWR7	0.480	0.403	4.965E-23	489	0.264	0.219	Q1LWR7.pdb.gz
11	PDB:1ei3C	0.484	0.494	6.997E-21	397	0.281	0.287	1ei3C.pdb.gz
12	PDB:3ghgI	0.480	0.494	2.889E-20	394	0.266	0.274	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
13	PDB:3ghgB	0.468	0.473	9.988E-20	401	0.236	0.239	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
14	PDB:1m1jB	0.480	0.485	2.153E-19	402	0.219	0.221	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
15	PDB:1jc9A	0.452	0.812	5.877E-19	220	0.180	0.332	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
16	PDB:4wmqA	0.243	0.326	7.598E-4	283	0.069	0.099	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
17	PDB:5zc0A	0.183	0.252	1.372E-3	281	0.052	0.075	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
18	PDB:4qvbB	0.083	0.208	3.755E-1	144	0.022	0.062	4qvbB.pdb.gz	Molecular insights into the binding of coenzyme F420 to the conserved protein Rv1155 from Mycobacterium tuberculosis.
19	PDB:1wv4A	0.081	0.156	5.046E-1	162	0.022	0.056	1wv4A.pdb.gz	Structure of Escherichia coli pyridoxine 5'-phosphate oxidase in a tetragonal crystal form: insights into the mechanistic pathway of the enzyme.
20	PDB:1t9mA	0.091	0.138	5.678E-1	204	0.057	0.113	1t9mA.pdb.gz	Structure of the phenazine biosynthesis enzyme PhzG.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6TMA8	0.0	634	405	0.766	0.768	ANGL4_RAT Angiopoietin-related protein 4 OS=Rattus norvegicus OX=10116 GN=Angptl4 PE=1 SV=1
2	Q8CEZ7	0.0	564	372	0.692	0.755	Q8CEZ7_MOUSE Fibrinogen C-terminal domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Angptl4 PE=2 SV=1
3	Q9BY76	0.0	837	406	1.000	1.000	ANGL4_HUMAN Angiopoietin-related protein 4 OS=Homo sapiens OX=9606 GN=ANGPTL4 PE=1 SV=2
4	Q9Z1P8	0.0	625	410	0.766	0.759	ANGL4_MOUSE Angiopoietin-related protein 4 OS=Mus musculus OX=10090 GN=Angptl4 PE=1 SV=1
5	B1B565	3.95e-60	204	464	0.333	0.291	B1B565_CHICK Angiopoietin-like protein 3 OS=Gallus gallus OX=9031 PE=2 SV=1
6	Q9Y5C1	6.05e-60	203	460	0.325	0.287	ANGL3_HUMAN Angiopoietin-related protein 3 OS=Homo sapiens OX=9606 GN=ANGPTL3 PE=1 SV=1
7	Q9R182	2.62e-59	201	455	0.333	0.297	ANGL3_MOUSE Angiopoietin-related protein 3 OS=Mus musculus OX=10090 GN=Angptl3 PE=1 SV=1
8	F7FHP0	1.37e-53	186	455	0.315	0.281	F7FHP0_RAT Angiopoietin-like 3 OS=Rattus norvegicus OX=10116 GN=Angptl3 PE=4 SV=1
9	O35608	1.72e-51	181	496	0.300	0.246	ANGP2_MOUSE Angiopoietin-2 OS=Mus musculus OX=10090 GN=Angpt2 PE=2 SV=2
10	O35462	7.93e-50	177	496	0.291	0.238	ANGP2_RAT Angiopoietin-2 OS=Rattus norvegicus OX=10116 GN=Angpt2 PE=2 SV=2
11	O15123	2.93e-47	170	496	0.227	0.185	ANGP2_HUMAN Angiopoietin-2 OS=Homo sapiens OX=9606 GN=ANGPT2 PE=1 SV=1
12	Q08830	9.60e-47	164	312	0.229	0.298	FGL1_HUMAN Fibrinogen-like protein 1 OS=Homo sapiens OX=9606 GN=FGL1 PE=1 SV=3
13	Q15389	4.33e-46	167	498	0.227	0.185	ANGP1_HUMAN Angiopoietin-1 OS=Homo sapiens OX=9606 GN=ANGPT1 PE=1 SV=2
14	O08538	5.49e-46	167	498	0.227	0.185	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
15	O35460	5.62e-46	167	497	0.224	0.183	ANGP1_RAT Angiopoietin-1 OS=Rattus norvegicus OX=10116 GN=Angpt1 PE=2 SV=2
16	Q71KU9	2.61e-44	158	314	0.214	0.277	FGL1_MOUSE Fibrinogen-like protein 1 OS=Mus musculus OX=10090 GN=Fgl1 PE=1 SV=2
17	O95841	2.73e-44	162	491	0.217	0.179	ANGL1_HUMAN Angiopoietin-related protein 1 OS=Homo sapiens OX=9606 GN=ANGPTL1 PE=2 SV=1
18	Q9Y264	8.35e-44	161	503	0.227	0.183	ANGP4_HUMAN Angiopoietin-4 OS=Homo sapiens OX=9606 GN=ANGPT4 PE=1 SV=1
19	F1QG23	1.77e-43	156	335	0.236	0.287	F1QG23_DANRE Fibrinogen-like protein 1 isoform X2 OS=Danio rerio OX=7955 GN=si:ch211-287a12.9 PE=4 SV=2
20	Q640P2	2.35e-43	159	490	0.212	0.176	ANGL1_MOUSE Angiopoietin-related protein 1 OS=Mus musculus OX=10090 GN=Angptl1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10186 ATG14	1.9e+02	12.5	Vacuolar sorting 38 and autophagy-related subunit 14
2	PF04977 DivIC	2e+02	13.1	Septum formation initiator
3	PF02601 Exonuc_VII_L	1.8e+02	13.1	Exonuclease VII, large subunit
4	PF00147 Fibrinogen_C	6.9e-53	191.3	Fibrinogen beta and gamma chains, C-terminal globular domain
5	PF14479 HeLo	67	14.8	Prion-inhibition and propagation
6	PF17111 Helo_like_N	5.2e+02	11.4	Fungal N-terminal domain of STAND proteins
7	PF04102 SlyX	13	17.9	SlyX

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301455

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309757	0.991	Lipoprotein lipase
2	9606.ENSP00000480053	0.971	Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
3	9606.ENSP00000385523	0.966	Peroxisome proliferator-activated receptor alpha
4	9606.ENSP00000479969	0.962	Angiopoietin-like protein 8
5	9606.ENSP00000287820	0.960	Peroxisome proliferator-activated receptor gamma
6	9606.ENSP00000264867	0.936	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
7	9606.ENSP00000379350	0.933	Integrin beta-1
8	9606.ENSP00000419692	0.918	Retinoic acid receptor RXR-alpha
9	9606.ENSP00000263253	0.911	Histone acetyltransferase p300
10	9606.ENSP00000262367	0.909	CREB-binding protein
11	9606.ENSP00000361066	0.908	Nuclear receptor coactivator 3
12	9606.ENSP00000325690	0.907	Histone-arginine methyltransferase CARM1
13	9606.ENSP00000385216	0.907	Nuclear receptor coactivator 1
14	9606.ENSP00000217964	0.905	F-box-like/WD repeat-containing protein TBL1X
15	9606.ENSP00000300651	0.905	Mediator of RNA polymerase II transcription subunit 1
16	9606.ENSP00000281928	0.904	Mediator of RNA polymerase II transcription subunit 13-like
17	9606.ENSP00000399968	0.904	Nuclear receptor coactivator 2
18	9606.ENSP00000263205	0.902	Mediator of RNA polymerase II transcription subunit 15
19	9606.ENSP00000405574	0.902	F-box-like/WD repeat-containing protein TBL1XR1
20	9606.ENSP00000457466	0.902	Chromodomain-helicase-DNA-binding protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0030234	0.999	enzyme regulator activity
GO:0140678	0.995	molecular function inhibitor activity
GO:0004857	0.885	enzyme inhibitor activity
GO:0005102	0.531	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0060191	0.950	regulation of lipase activity
GO:0048519	0.928	negative regulation of biological process
GO:0043086	0.922	negative regulation of catalytic activity
GO:0048523	0.908	negative regulation of cellular process
GO:0048518	0.893	positive regulation of biological process
GO:0010941	0.812	regulation of cell death
GO:0019222	0.799	regulation of metabolic process
GO:0043066	0.790	negative regulation of apoptotic process
GO:0051239	0.776	regulation of multicellular organismal process
GO:0050793	0.766	regulation of developmental process
GO:0050896	0.765	response to stimulus
GO:0080090	0.735	regulation of primary metabolic process
GO:0051346	0.693	negative regulation of hydrolase activity
GO:0048522	0.669	positive regulation of cellular process
GO:1901342	0.474	regulation of vasculature development
GO:0071704	0.455	organic substance metabolic process
GO:0051240	0.381	positive regulation of multicellular organismal process
GO:0044238	0.359	primary metabolic process
GO:0032501	0.315	multicellular organismal process
GO:0031323	0.313	regulation of cellular metabolic process
GO:0060255	0.310	regulation of macromolecule metabolic process
GO:0051716	0.306	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.996	extracellular region
GO:0005615	0.992	extracellular space
GO:0032991	0.921	protein-containing complex
GO:0072562	0.470	blood microparticle
GO:0070013	0.407	intracellular organelle lumen
GO:0005634	0.345	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]