StarFunc result for job id Q9BY84

User Input

>input (665 residues)
MAHEMIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQ
DKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHL
LAGGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKELM
QQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCV
LVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKKIKN
QTGASGPKSKLKLLHLEKPNEPVPAVSEGGQKSETPLSPPCADSATSEAAGQRPVHPASV
PSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGF
SSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKKLQTARPSDSQ
SKRLHSVRTSSSGTAQRSLLSPLHRSGSVEDNYHTSFLFGLSTSQQHLTKSAGLGLKGWH
SDILAPQTSTPSLTSSWYFATESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRR
QKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSME
IIEVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAR2	0.431	0.431	0.000	665	1.000	1.000	A0A024RAR2.pdb.gz
2	AFDB:O09112	0.269	0.270	5.519E-58	663	0.442	0.443	O09112.pdb.gz	DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus OX=10090 GN=Dusp8 PE=2 SV=1
3	AFDB:Q10038	0.244	0.247	1.280E-35	657	0.266	0.269	Q10038.pdb.gz	VHP1_CAEEL Tyrosine-protein phosphatase vhp-1 OS=Caenorhabditis elegans OX=6239 GN=vhp-1 PE=1 SV=2
4	PDB:6d66A	0.211	0.271	1.761E-18	517	0.093	0.120	6d66A.pdb.gz
5	PDB:2esbA	0.208	0.834	3.801E-16	162	0.074	0.302	2esbA.pdb.gz
6	PDB:2wgpA	0.205	0.793	8.047E-16	168	0.081	0.321	2wgpA.pdb.gz
7	PDB:5y15A	0.206	0.894	4.929E-15	148	0.074	0.331	5y15A.pdb.gz
8	PDB:3f81A	0.215	0.748	2.717E-12	179	0.081	0.302	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
9	PDB:2gwoC	0.200	0.728	5.403E-12	174	0.065	0.247	2gwoC.pdb.gz
10	PDB:2y96A	0.208	0.751	2.275E-11	175	0.069	0.263	2y96A.pdb.gz
11	PDB:5xjvB	0.202	0.749	3.109E-11	171	0.078	0.304	5xjvB.pdb.gz
12	PDB:2q05A	0.177	0.597	1.697E-9	181	0.063	0.232	2q05A.pdb.gz
13	PDB:4ercA	0.186	0.763	4.960E-8	150	0.044	0.193	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
14	AFDB:P35831	0.136	0.119	5.344E-4	775	0.153	0.132	P35831.pdb.gz	PTN12_MOUSE Tyrosine-protein phosphatase non-receptor type 12 OS=Mus musculus OX=10090 GN=Ptpn12 PE=1 SV=3
15	AFDB:D4A2D5	0.096	0.081	3.274E-3	804	0.123	0.102	D4A2D5.pdb.gz	D4A2D5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn22 PE=1 SV=1
16	AFDB:Q9Y2R2	0.146	0.126	5.070E-3	807	0.113	0.093	Q9Y2R2.pdb.gz	PTN22_HUMAN Tyrosine-protein phosphatase non-receptor type 22 OS=Homo sapiens OX=9606 GN=PTPN22 PE=1 SV=2
17	AFDB:P29352	0.135	0.115	5.745E-3	802	0.137	0.113	P29352.pdb.gz	PTN22_MOUSE Tyrosine-protein phosphatase non-receptor type 22 OS=Mus musculus OX=10090 GN=Ptpn22 PE=1 SV=1
18	AFDB:Q3KP66	0.050	0.050	1.787E-1	663	0.110	0.110	Q3KP66.pdb.gz	INAVA_HUMAN Innate immunity activator protein OS=Homo sapiens OX=9606 GN=INAVA PE=1 SV=2
19	AFDB:Q2UY09	0.087	0.058	4.563E-1	1125	0.126	0.075	Q2UY09.pdb.gz	COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens OX=9606 GN=COL28A1 PE=2 SV=2
20	AFDB:M9NEG1	0.081	0.054	5.504E-1	1109	0.086	0.051	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A3W6	0.0	1239	661	0.905	0.911	D4A3W6_RAT Dual specificity phosphatase 16 OS=Rattus norvegicus OX=10116 GN=Dusp16 PE=1 SV=1
2	Q9BY84	0.0	1367	665	1.000	1.000	DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens OX=9606 GN=DUSP16 PE=1 SV=1
3	O09112	1.31e-147	445	663	0.352	0.353	DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus OX=10090 GN=Dusp8 PE=2 SV=1
4	Q10038	1.64e-62	221	657	0.195	0.198	VHP1_CAEEL Tyrosine-protein phosphatase vhp-1 OS=Caenorhabditis elegans OX=6239 GN=vhp-1 PE=1 SV=2
5	Q7SZF3	2.22e-51	184	367	0.173	0.313	Q7SZF3_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=zgc:55423 PE=2 SV=1
6	P28563	5.85e-46	169	367	0.156	0.283	DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1
7	Q9ESS0	2.53e-45	170	483	0.159	0.219	DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus OX=10090 GN=Dusp10 PE=2 SV=2
8	Q16829	4.59e-45	168	419	0.156	0.248	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
9	Q9Y6W6	4.97e-45	169	482	0.162	0.224	DUS10_HUMAN Dual specificity protein phosphatase 10 OS=Homo sapiens OX=9606 GN=DUSP10 PE=1 SV=1
10	Q13115	5.00e-45	167	394	0.144	0.244	DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens OX=9606 GN=DUSP4 PE=1 SV=1
11	P28562	5.11e-45	166	367	0.155	0.281	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
12	D3ZBG7	8.22e-45	169	482	0.158	0.218	D3ZBG7_RAT Dual specificity phosphatase 10 OS=Rattus norvegicus OX=10116 GN=Dusp10 PE=3 SV=1
13	Q05922	1.26e-44	164	318	0.159	0.333	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
14	Q05923	1.40e-44	164	314	0.162	0.344	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
15	Q62767	3.11e-44	165	395	0.161	0.271	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
16	Q64623	4.66e-44	164	367	0.153	0.278	DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Dusp1 PE=1 SV=1
17	Q7T2L8	1.47e-43	163	382	0.150	0.262	Q7T2L8_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=mkp3 PE=2 SV=1
18	Q16828	4.74e-43	161	381	0.162	0.283	DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens OX=9606 GN=DUSP6 PE=1 SV=2
19	Q64346	2.59e-42	159	381	0.161	0.281	DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus OX=10116 GN=Dusp6 PE=1 SV=1
20	Q9DBB1	3.13e-42	159	381	0.165	0.289	DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus OX=10090 GN=Dusp6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	6.1e-40	147.5	Dual specificity phosphatase, catalytic domain
2	PF14566 PTPlike_phytase	5.4e+02	12.1	Inositol hexakisphosphate
3	PF00581 Rhodanese	1.9e-12	59.0	Rhodanese-like domain
4	PF00102 Y_phosphatase	1.2	20.2	Protein-tyrosine phosphatase
5	PF17978 zf-RING_14	91	14.9	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298573

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229795	0.991	Mitogen-activated protein kinase 14
2	9606.ENSP00000378974	0.987	Mitogen-activated protein kinase 8
3	9606.ENSP00000241014	0.983	C-Jun-amino-terminal kinase-interacting protein 1
4	9606.ENSP00000333685	0.968	Mitogen-activated protein kinase 11
5	9606.ENSP00000215832	0.967	Mitogen-activated protein kinase 1
6	9606.ENSP00000263025	0.939	Mitogen-activated protein kinase 3
7	9606.ENSP00000394560	0.913	Mitogen-activated protein kinase 9
8	9606.ENSP00000352157	0.881	Mitogen-activated protein kinase 10
9	9606.ENSP00000211287	0.858	Mitogen-activated protein kinase 13
10	9606.ENSP00000215659	0.857	Mitogen-activated protein kinase 12
11	9606.ENSP00000222567	0.781	DNA-directed RNA polymerase I subunit RPA43
12	9606.ENSP00000295926	0.659	Cyclin-L1
13	9606.ENSP00000331103	0.648	Inositol hexakisphosphate kinase 2
14	9606.ENSP00000379032	0.630	Exostosin-2
15	9606.ENSP00000321546	0.568	BLOC-1-related complex subunit 5
16	9606.ENSP00000085068	0.556	Isochorismatase domain containing 2
17	9606.ENSP00000381070	0.552	Dual specificity mitogen-activated protein kinase kinase 7
18	9606.ENSP00000414202	0.542	Serine/threonine-protein phosphatase 6 regulatory subunit 1
19	9606.ENSP00000298910	0.541	Leucine-rich repeat serine/threonine-protein kinase 2
20	9606.ENSP00000228865	0.540	cAMP-responsive element-binding protein-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004721	1.000	phosphoprotein phosphatase activity
GO:0019901	0.997	protein kinase binding
GO:0051019	0.981	mitogen-activated protein kinase binding
GO:0008138	0.905	protein tyrosine/serine/threonine phosphatase activity
GO:0016740	0.335	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.993	cellular metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0050790	0.986	regulation of catalytic activity
GO:0051246	0.986	regulation of protein metabolic process
GO:0048523	0.985	negative regulation of cellular process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0045859	0.977	regulation of protein kinase activity
GO:0031400	0.973	negative regulation of protein modification process
GO:0044092	0.967	negative regulation of molecular function
GO:0043409	0.965	negative regulation of MAPK cascade
GO:0036211	0.963	protein modification process
GO:0080134	0.959	regulation of response to stress
GO:0006469	0.959	negative regulation of protein kinase activity
GO:0016311	0.958	dephosphorylation
GO:0071900	0.958	regulation of protein serine/threonine kinase activity
GO:0071901	0.949	negative regulation of protein serine/threonine kinase activity
GO:0032872	0.947	regulation of stress-activated MAPK cascade
GO:0043405	0.928	regulation of MAP kinase activity
GO:0043506	0.924	regulation of JUN kinase activity
GO:0046328	0.885	regulation of JNK cascade
GO:0051641	0.880	cellular localization
GO:0033036	0.861	macromolecule localization
GO:0051649	0.858	establishment of localization in cell
GO:0070303	0.843	negative regulation of stress-activated protein kinase signaling cascade
GO:0006810	0.813	transport
GO:0032873	0.800	negative regulation of stress-activated MAPK cascade
GO:0006470	0.798	protein dephosphorylation
GO:0046907	0.771	intracellular transport
GO:0046329	0.740	negative regulation of JNK cascade
GO:0071702	0.739	organic substance transport
GO:0008104	0.717	protein localization
GO:0043407	0.717	negative regulation of MAP kinase activity
GO:0045184	0.705	establishment of protein localization
GO:0071705	0.697	nitrogen compound transport
GO:0051169	0.677	nuclear transport
GO:0015031	0.646	protein transport
GO:0006886	0.593	intracellular protein transport
GO:0006913	0.551	nucleocytoplasmic transport
GO:0050896	0.537	response to stimulus
GO:0048518	0.517	positive regulation of biological process
GO:0048522	0.421	positive regulation of cellular process
GO:0051716	0.372	cellular response to stimulus
GO:0051168	0.343	nuclear export
GO:0006611	0.304	protein export from nucleus
GO:0007154	0.303	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.997	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
EC:2.-.-.-	0.335	Transferases.

[back to server]