StarFunc result for job id Q9BY89

User Input

>input (1806 residues)
MATRVEVGSITPLTAVPGLGEMGKEETLTRTYFLQAGEASGAPPARILEAKSPLRSPARL
LPLPRLAPKPFSKEQDVKSPVPSLRPSSTGPSPSGGLSEEPAAKDLDNRMPGLVGQEVGS
GEGPRTSSPLFNKAVFLRPSSSTMILFETTKSGPALGKAVSEGAEEAKLGVSGSRPEVAA
KPALPTQKPAGTLPRSAPLSQDTKPPVPQEEAGQDHPPSKASSVEDTARPLVEPRPRLKR
RPVSAIFTESIQPQKPGPGAAATVGKVPPTPPEKTWVRKPRPLSMDLTARFENKEALLRK
VADEGSGPTAGDMAGLERPRAASKLDRDCLVKAEAPLHDPDLDFLEVAKKIRERKEKMLS
KPEMGSPRALVGGSSGVTPSNDQSPWEEKAKLDPEPEKAAESPSPRLGRGLELAEVKSRV
ADGEAAAGGEWASRRSVRKCISLFREDSTLALAVGSESPLATPASPSAAPEPEKGVVSVQ
ERIRGWTAESSEAKPEVRRRTFQARPLSADLTKLFSSSASSNEVKYEKSAELSGEFPKEP
REKQKEGHSLDGACIPRSPWKPGTLRDKSRQTEQKVSSNQDPDSCRGGSSVEAPCPSDVT
PEDDRSFQTVWATVFEHHVERHTVADQSGRCLSTTPPGDMAHARVSEPRPRPEMGSWLGR
DPPDMTKLKKENSRGFDNPETEKLGPTTLLNGELRPYHTPLRDKYPLSENHNNNTFLKHL
ENPPTSQRIEPRYDIVHAVGERVHSEAISPAPEEKAVTLRSLRSWLSLKDRQLSQEVTPA
DLECGLEGQAGSVQRASLIWEARGMPEASGPKFGGNCPFPKWTGGAVVSSHKATVAVSEE
HCAPGATSVRAIKAAIWESQHEGPEGARSKPGVGARGPPQGCPLDPLSRATNGPSDSQAR
THPDAFAVQKGPFIVAAREGDPGPAQVPQPAVRMRKAGAMDQRMDRWRRRTLPPNVKFDT
FSSLVPEDSPHVGHRRTDYVSPTASALRKPQLSHYRVETQEVNPGASRDQTSPAVKQGSP
VEPKATFFAVTYQIPNTQKAKGVVLSGAESLLEHSRKITPPSSPHSLTSTLVSLGHEEAL
EMAGSKNWMKGREHENASILKTLKPTDRPSSLGAWSLDPFNGRIIDVDALWSHRGSEDGP
RPQSNWKESANKMSPSGGAPQTTPTLRSRPKDLPVRRKTDVISDTFPGKIRDGYRSSVLD
IDALMAEYQELSLKVPGEAQERRSPTVEPSTLPRERPVQLGGVEQRRRSLKEMPDTGGLW
KPASSAEINHSFTPGLGKQLAETLETAMGTKSSPPFWALPPSAPSERYPGGSPIPADPRK
KTGFAEDDRKAFASKHHVAKCQNYLAESKPSGREDPGSGVRVSPKSPPTDQKKGTPRKST
GRGEEDSVAQWGDHPRDCGRVPLDIKRAYSEKGPPANIREGLSIMHEARERRREQPKGRP
SLTGENLEAKMGPCWWESGTGDSHKVLPRDLEKEDAPQEKERPLQQVSPVASVPWRSHSF
CKDRRSGPFVDQLKQCFSRQPTEPKDTDTLVHEAGSQYGTWTEQCQSGESLATESPDSSA
TSTRKQPPSSRLSSLSSQTEPTSAGDQYDCSRDQRSTSVDHSSTDLESTDGMEGPPPPDA
CPEKRVDDFSFIDQTSVLDSSALKTRVQLSKRSRRRAPISHSLRRSRFSESESRSPLEDE
TDNTWMFKDSTEEKSPRKEESDEEETASKAERTPVSHPQRMPAFPGMDPAVLKAQLHKRP
EVDSPGETPSWAPQPKSPKSPFQPGVLGSRVLPSSMDKDERSDEPSPQWLKELKSKKRQS
LYENQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0C2	0.028	0.029	6.687E-4	1729	0.176	0.183	Q9C0C2.pdb.gz	TB182_HUMAN 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4
2	AFDB:E7F630	0.036	0.030	7.204E-4	2394	0.150	0.113	E7F630.pdb.gz
3	AFDB:P97868	0.028	0.028	2.371E-3	1790	0.127	0.128	P97868.pdb.gz	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
4	AFDB:P18583	0.033	0.030	2.055E-2	2426	0.168	0.125	P18583.pdb.gz	SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4
5	AFDB:Q7Z6E9	0.028	0.028	2.214E-2	1792	0.126	0.127	Q7Z6E9.pdb.gz	RBBP6_HUMAN E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1
6	AFDB:Q8I1Y8	0.031	0.027	2.385E-2	2271	0.100	0.080	Q8I1Y8.pdb.gz	Q8I1Y8_PLAF7 AP2 domain transcription factor AP2-SP2, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0404100 PE=4 SV=2
7	AFDB:Q5QNQ9	0.026	0.025	2.569E-2	1845	0.151	0.148	Q5QNQ9.pdb.gz	CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus OX=10090 GN=Col27a1 PE=2 SV=1
8	AFDB:Q9VU86	0.029	0.028	3.460E-2	1873	0.128	0.124	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
9	AFDB:Q56A10	0.027	0.031	3.728E-2	1511	0.123	0.147	Q56A10.pdb.gz	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
10	AFDB:O96201	0.029	0.028	7.849E-2	1844	0.095	0.093	O96201.pdb.gz	O96201_PLAF7 Transcription factor with AP2 domain(S) OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0212100 PE=4 SV=1
11	PDB:6hivDD	0.020	0.040	9.416	791	0.006	0.014	6hivDD.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R542	9.97e-07	56.6	1729	0.022	0.023	A0A024R542_HUMAN Testis secretory sperm-binding protein Li 206a OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q9C0C2	9.97e-07	56.6	1729	0.022	0.023	TB182_HUMAN 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4
3	Q9D7Z6	0.57	37.4	913	0.028	0.055	CLCA1_MOUSE Calcium-activated chloride channel regulator 1 OS=Mus musculus OX=10090 GN=Clca1 PE=1 SV=2
4	M9PCJ6	2.4	35.8	18641	0.032	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
5	M9PC48	2.5	35.8	18095	0.032	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
6	Q2I0M5	3.5	34.3	234	0.008	0.064	RSPO4_HUMAN R-spondin-4 OS=Homo sapiens OX=9606 GN=RSPO4 PE=1 SV=2
7	H3BL28	4.7	34.7	1042	0.013	0.022	H3BL28_MOUSE Protein phosphatase 1, regulatory subunit 9A (Fragment) OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
8	Q3UUK5	4.7	34.7	1042	0.013	0.022	Q3UUK5_MOUSE Neurabin-1 (Fragment) OS=Mus musculus OX=10090 GN=Ppp1r9a PE=2 SV=1
9	O35867	4.8	34.7	1095	0.013	0.021	NEB1_RAT Neurabin-1 OS=Rattus norvegicus OX=10116 GN=Ppp1r9a PE=1 SV=1
10	A0A0B4K8A2	4.9	34.3	508	0.014	0.051	A0A0B4K8A2_DROME Smooth, isoform AA OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
11	Q7TN74	5.3	34.3	1095	0.013	0.021	Q7TN74_MOUSE Neurabin I OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
12	Q9ULJ8	6.8	33.9	1098	0.013	0.021	NEB1_HUMAN Neurabin-1 OS=Homo sapiens OX=9606 GN=PPP1R9A PE=1 SV=2
13	Q7TSA7	9.1	33.5	969	0.012	0.022	Q7TSA7_MOUSE Ppp1r9a protein OS=Mus musculus OX=10090 GN=Ppp1r9a PE=2 SV=1
14	H3BJD0	9.4	33.5	977	0.012	0.021	H3BJD0_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
15	H3BKQ7	9.6	33.5	955	0.012	0.022	H3BKQ7_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15327 Tankyrase_bdg_C	5.3e-59	210.9	Tankyrase binding protein C terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351207

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258214	0.788	Coiled-coil domain containing 102A
2	9606.ENSP00000412673	0.640	Gamma-aminobutyric acid receptor subunit rho-1
3	9606.ENSP00000349929	0.624	Serologically defined colon cancer antigen 3
4	9606.ENSP00000336729	0.612	Polypeptide N-acetylgalactosaminyltransferase 16
5	9606.ENSP00000170564	0.606	G-patch domain containing 1
6	9606.ENSP00000295124	0.576	Coiled-coil domain containing 138
7	9606.ENSP00000362711	0.549	Alpha-taxilin
8	9606.ENSP00000239830	0.532	Coiled-coil domain containing 77
9	9606.ENSP00000482907	0.516	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
10	9606.ENSP00000368759	0.506	Enhancer of filamentation 1
11	9606.ENSP00000386166	0.503	Proline rich 21
12	9606.ENSP00000342188	0.502	Leucine rich repeats and IQ motif containing 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0009987	0.964	cellular process
GO:0048518	0.461	positive regulation of biological process
GO:0048522	0.383	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005856	0.988	cytoskeleton
GO:0005737	0.937	cytoplasm
GO:0016020	0.899	membrane
GO:0043227	0.852	membrane-bounded organelle
GO:0071944	0.802	cell periphery
GO:0043231	0.641	intracellular membrane-bounded organelle
GO:0015629	0.503	actin cytoskeleton
GO:0005886	0.460	plasma membrane
GO:0005634	0.408	nucleus
GO:0005829	0.354	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]