StarFunc result for job id Q9BYB0

User Input

>input (1731 residues)
MDGPGASAVVVRVGIPDLQQTKCLRLDPAAPVWAAKQRVLCALNHSLQDALNYGLFQPPS
RGRAGKFLDEERLLQEYPPNLDTPLPYLEFRYKRRVYAQNLIDDKQFAKLHTKANLKKFM
DYVQLHSTDKVARLLDKGLDPNFHDPDSGECPLSLAAQLDNATDLLKVLKNGGAHLDFRT
RDGLTAVHCATRQRNAAALTTLLDLGASPDYKDSRGLTPLYHSALGGGDALCCELLLHDH
AQLGITDENGWQEIHQACRFGHVQHLEHLLFYGADMGAQNASGNTALHICALYNQESCAR
VLLFRGANRDVRNYNSQTAFQVAIIAGNFELAEVIKTHKDSDVVPFRETPSYAKRRRLAG
PSGLASPRPLQRSASDINLKGEAQPAASPGPSLRSLPHQLLLQRLQEEKDRDRDADQESN
ISGPLAGRAGQSKISPSGPGGPGPAPGPGPAPPAPPAPPPRGPKRKLYSAVPGRKFIAVK
AHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQHDTRPETR
EDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAVLQKRDHEGFGFVLRGAKAETPIEEFTP
TPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVGHKQVVALIRQGGNRLVMK
VVSVTRKPEEDGARRRAPPPPKRAPSTTLTLRSKSMTAELEELASIRRRKGEKLDEMLAA
AAEPTLRPDIADADSRAATVKQRPTSRRITPAEISSLFERQGLPGPEKLPGSLRKGIPRT
KSVGEDEKLASLLEGRFPRSTSMQDPVREGRGIPPPPQTAPPPPPAPYYFDSGPPPAFSP
PPPPGRAYDTVRSSFKPGLEARLGAGAAGLYEPGAALGPLPYPERQKRARSMIILQDSAP
ESGDAPRPPPAATPPERPKRRPRPPGPDSPYANLGAFSASLFAPSKPQRRKSPLVKQLQV
EDAQERAALAVGSPGPGGGSFAREPSPTHRGPRPGGLDYGAGDGPGLAFGGPGPAKDRRL
EERRRSTVFLSVGAIEGSAPGADLPSLQPSRSIDERLLGTGPTAGRDLLLPSPVSALKPL
VSGPSLGPSGSTFIHPLTGKPLDPSSPLALALAARERALASQAPSRSPTPVHSPDADRPG
PLFVDVQARDPERGSLASPAFSPRSPAWIPVPARREAEKVPREERKSPEDKKSMILSVLD
TSLQRPAGLIVVHATSNGQEPSRLGGAEEERPGTPELAPAPMQSAAVAEPLPSPRAQPPG
GTPADAGPGQGSSEEEPELVFAVNLPPAQLSSSDEETREELARIGLVPPPEEFANGVLLA
TPLAGPGPSPTTVPSPASGKPSSEPPPAPESAADSGVEEADTRSSSDPHLETTSTISTVS
SMSTLSSESGELTDTHTSFADGHTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQSSDS
ELMAQQHHAASAGLASAAGPARPRYLFQRRSKLWGDPVESRGLPGPEDDKPTVISELSSR
LQQLNKDTRSLGEEPVGGLGSLLDPAKKSPIAAARLFSSLGELSSISAQRSPGGPGGGAS
YSVRPSGRYPVARRAPSPVKPASLERVEGLGAGAGGAGRPFGLTPPTILKSSSLSIPHEP
KEVRFVVRSVSARSRSPSPSPLPSPASGPGPGAPGPRRPFQQKPLQLWSKFDVGDWLESI
HLGEHRDRFEDHEIEGAHLPALTKDDFVELGVTRVGHRMNIERALRQLDGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3YZU1	0.234	0.191	0.000	2167	0.453	0.362	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
2	AFDB:F1QJ05	0.144	0.164	0.000	1509	0.541	0.620	F1QJ05.pdb.gz
3	AFDB:F1R0Q7	0.273	0.286	0.000	1631	0.574	0.609	F1R0Q7.pdb.gz
4	AFDB:Q9JLU4	0.440	0.438	0.000	1740	0.954	0.949	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
5	AFDB:A8WGS9	0.236	0.526	1.782E-78	727	0.235	0.560	A8WGS9.pdb.gz
6	AFDB:A1Z9K8	0.205	0.190	1.236E-68	1871	0.259	0.239	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
7	AFDB:Q9UPX8	0.102	0.116	1.690E-64	1470	0.334	0.393	Q9UPX8.pdb.gz	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
8	AFDB:Q80Z38	0.097	0.111	2.096E-63	1476	0.335	0.393	Q80Z38.pdb.gz	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
9	AFDB:F1QBX1	0.053	0.068	5.039E-49	1170	0.359	0.531	F1QBX1.pdb.gz
10	AFDB:O70511	0.124	0.082	6.546E-17	2622	0.163	0.108	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
11	PDB:8cs9A	0.124	0.266	3.318E-14	796	0.036	0.079	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.121	0.847	2.371E-12	229	0.031	0.236	2dvwA.pdb.gz
13	PDB:1wg0A	0.121	0.763	7.058E-11	243	0.027	0.189	1wg0A.pdb.gz
14	PDB:4oauC	0.119	0.282	7.058E-11	692	0.034	0.085	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:5vkqA	0.106	0.121	8.719E-9	1499	0.035	0.040	5vkqA.pdb.gz
16	PDB:6jd6B	0.089	0.742	1.776E-8	192	0.026	0.234	6jd6B.pdb.gz
17	PDB:6mwqA	0.085	0.291	1.776E-8	493	0.029	0.101	6mwqA.pdb.gz
18	PDB:6aunA	0.116	0.315	3.822E-8	618	0.032	0.091	6aunA.pdb.gz
19	PDB:6v9hC	0.118	0.683	4.264E-8	270	0.027	0.170	6v9hC.pdb.gz
20	PDB:6e2fC	0.102	0.262	1.974E-7	647	0.031	0.082	6e2fC.pdb.gz	Mechanism of calmodulin inactivation of the calcium-selective TRP channel TRPV6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4ACU6	0.0	2829	1730	0.949	0.949	SHAN3_MOUSE SH3 and multiple ankyrin repeat domains protein 3 OS=Mus musculus OX=10090 GN=Shank3 PE=1 SV=3
2	Q80Z38	0.0	655	1476	0.350	0.410	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
3	Q9BYB0	0.0	3427	1731	1.000	1.000	SHAN3_HUMAN SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens OX=9606 GN=SHANK3 PE=1 SV=3
4	Q9JLU4	0.0	2817	1740	0.945	0.940	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
5	Q9QX74	0.0	660	1474	0.347	0.408	SHAN2_RAT SH3 and multiple ankyrin repeat domains protein 2 OS=Rattus norvegicus OX=10116 GN=Shank2 PE=1 SV=2
6	Q9UPX8	0.0	1219	1849	0.484	0.453	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
7	Q9WV48	6.10e-162	547	2167	0.143	0.114	SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus OX=10116 GN=Shank1 PE=1 SV=1
8	D3YZU1	6.46e-162	547	2167	0.143	0.114	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
9	H9KV90	9.01e-161	544	2169	0.142	0.113	H9KV90_HUMAN SH3 and multiple ankyrin repeat domains 1 OS=Homo sapiens OX=9606 GN=SHANK1 PE=1 SV=1
10	Q9Y566	1.01e-160	543	2161	0.142	0.114	SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens OX=9606 GN=SHANK1 PE=1 SV=2
11	A1Z9K8	1.37e-114	405	1871	0.107	0.099	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
12	A0A0B4LFA9	2.77e-110	390	1725	0.103	0.103	A0A0B4LFA9_DROME Prosap, isoform C OS=Drosophila melanogaster OX=7227 GN=Prosap PE=4 SV=1
13	B7WN72	2.65e-90	322	1140	0.094	0.143	SHANK_CAEEL Protein shank OS=Caenorhabditis elegans OX=6239 GN=shn-1 PE=1 SV=1
14	A0A0B4LF25	4.24e-69	260	1660	0.070	0.073	A0A0B4LF25_DROME Prosap, isoform E OS=Drosophila melanogaster OX=7227 GN=Prosap PE=4 SV=1
15	A0A0B4K7Z0	6.24e-69	260	1806	0.070	0.067	A0A0B4K7Z0_DROME Prosap, isoform D OS=Drosophila melanogaster OX=7227 GN=Prosap PE=4 SV=1
16	X2JCM1	5.02e-22	107	11634	0.034	0.005	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	M9MRX4	9.88e-22	106	13559	0.034	0.004	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	Q8C8R3	6.84e-20	100	3898	0.037	0.016	ANK2_MOUSE Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2
19	A0A5F9ZHF7	5.36e-19	97.1	3862	0.038	0.017	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZH19	6.35e-19	97.1	3895	0.038	0.017	A0A5F9ZH19_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	7.1e-05	34.3	Ankyrin repeat
2	PF12796 Ank_2	4e-16	70.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.00012	33.1	Ankyrin repeat
4	PF13637 Ank_4	1.5e-11	55.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.9e-07	41.5	Ankyrin repeats (many copies)
6	PF16511 FERM_f0	22	16.8	N-terminal or F0 domain of Talin-head FERM
7	PF00595 PDZ	0.0051	28.5	PDZ domain
8	PF17820 PDZ_6	9.3e-06	36.8	PDZ domain
9	PF00536 SAM_1	1.8e-17	74.8	SAM domain (Sterile alpha motif)
10	PF07647 SAM_2	1.7e-09	49.0	SAM domain (Sterile alpha motif)
11	PF00018 SH3_1	0.1	23.5	SH3 domain
12	PF07653 SH3_2	3.1e-08	44.6	Variant SH3 domain
13	PF14604 SH3_9	0.0008	30.6	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9707.XP_004409704.1

Rank	PPI partner	STRING score	Description
1	9707.XP_004402750.1	0.987	Disks large-associated protein 3
2	9707.XP_004414298.1	0.977	Disks large-associated protein 2 isoform X1
3	9707.XP_004412415.1	0.934	Disks large-associated protein 1 isoform X1
4	9707.XP_004409995.1	0.921	SH3 and multiple ankyrin repeat domains protein 1
5	9707.XP_004398599.1	0.919	Belongs to the MAGUK family.
6	9707.XP_004393849.1	0.904	SH3 and multiple ankyrin repeat domains protein 2
7	9707.XP_004405648.1	0.901	Homer protein homolog 1 isoform 1
8	9707.XP_004415821.1	0.857	Disks large homolog 2-like isoform 1
9	9707.XP_004391929.1	0.843	Disks large homolog 1 isoform 1
10	9707.XP_004398311.1	0.842	Homer protein homolog 2 isoform 1
11	9707.XP_004393196.1	0.840	Disks large-associated protein 4 isoform 1
12	9707.XP_004411334.1	0.827	inaD-like protein isoform 1
13	9707.XP_004403400.1	0.825	Belongs to the MAGUK family.
14	9707.XP_004416700.1	0.805	Glutamate receptor ionotropic, NMDA 1 isoform 1
15	9707.XP_004417636.1	0.781	Interleukin-1 receptor accessory protein-like 1-like
16	9707.XP_004405707.1	0.779	Neurexin-1-beta-like isoform 1
17	9707.XP_004417861.1	0.779	LOW QUALITY PROTEIN: contactin-associated protein-like 2
18	9707.XP_004396670.1	0.775	Belongs to the MAGUK family.
19	9707.XP_004411138.1	0.767	Glutamate receptor ionotropic, NMDA 2B
20	9707.XP_004407769.1	0.763	ras/Rap GTPase-activating protein SynGAP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0099186	0.957	structural constituent of postsynapse
GO:0098879	0.794	structural constituent of postsynaptic specialization
GO:0098919	0.779	structural constituent of postsynaptic density
GO:0035591	0.768	signaling adaptor activity
GO:0017124	0.763	SH3 domain binding
GO:0097110	0.746	scaffold protein binding
GO:0030159	0.583	signaling receptor complex adaptor activity
GO:0030160	0.551	synaptic receptor adaptor activity
GO:0043621	0.516	protein self-association
GO:0044877	0.439	protein-containing complex binding
GO:0008270	0.438	zinc ion binding
GO:0042802	0.437	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007610	0.995	behavior
GO:0065007	0.987	biological regulation
GO:0003008	0.985	system process
GO:0050890	0.979	cognition
GO:0009987	0.977	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0035176	0.975	social behavior
GO:0034330	0.929	cell junction organization
GO:0007611	0.919	learning or memory
GO:0050896	0.905	response to stimulus
GO:0007612	0.890	learning
GO:0050808	0.884	synapse organization
GO:0010646	0.877	regulation of cell communication
GO:0023051	0.859	regulation of signaling
GO:0048856	0.855	anatomical structure development
GO:0065008	0.844	regulation of biological quality
GO:0048518	0.784	positive regulation of biological process
GO:0030534	0.761	adult behavior
GO:0050803	0.744	regulation of synapse structure or activity
GO:0048522	0.726	positive regulation of cellular process
GO:0050807	0.724	regulation of synapse organization
GO:0009628	0.720	response to abiotic stimulus
GO:0099173	0.705	postsynapse organization
GO:0009605	0.702	response to external stimulus
GO:0007275	0.689	multicellular organism development
GO:0048583	0.681	regulation of response to stimulus
GO:0009966	0.660	regulation of signal transduction
GO:0099175	0.648	regulation of postsynapse organization
GO:0048731	0.513	system development
GO:0007154	0.476	cell communication
GO:0007399	0.465	nervous system development
GO:0009612	0.428	response to mechanical stimulus
GO:0051179	0.411	localization
GO:0023056	0.408	positive regulation of signaling
GO:0023052	0.401	signaling
GO:0048869	0.395	cellular developmental process
GO:0030154	0.391	cell differentiation
GO:0048519	0.387	negative regulation of biological process
GO:0051716	0.384	cellular response to stimulus
GO:0050804	0.327	modulation of chemical synaptic transmission
GO:0010647	0.326	positive regulation of cell communication
GO:0048513	0.301	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045202	0.998	synapse
GO:0005737	0.997	cytoplasm
GO:0016020	0.994	membrane
GO:0071944	0.986	cell periphery
GO:0043226	0.986	organelle
GO:0005886	0.983	plasma membrane
GO:0098978	0.953	glutamatergic synapse
GO:0120025	0.947	plasma membrane bounded cell projection
GO:0005829	0.939	cytosol
GO:0098794	0.928	postsynapse
GO:0098984	0.844	neuron to neuron synapse
GO:0099572	0.831	postsynaptic specialization
GO:0032279	0.830	asymmetric synapse
GO:0043005	0.809	neuron projection
GO:0098590	0.767	plasma membrane region
GO:0043229	0.699	intracellular organelle
GO:0043227	0.667	membrane-bounded organelle
GO:0043232	0.540	intracellular non-membrane-bounded organelle
GO:0014069	0.534	postsynaptic density
GO:0070013	0.335	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]