StarFunc result for job id Q9BYC2

User Input

>input (517 residues)
MAALRLLASVLGRGVPAGGSGLALSQGCARCFATSPRLRAKFYADPVEMVKDISDGATVM
IGGFGLCGIPENLIAALLRTRVKDLQVVSSNVGVEDFGLGLLLAARQVRRIVCSYVGENT
LCESQYLAGELELELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGAPIRYTPDGHL
ALMSQPREVREFNGDHFLLERAIRADFALVKGWKADRAGNVVFRRSARNFNVPMCKAADV
TAVEVEEIVEVGAFPPEDIHVPNIYVDRVIKGQKYEKRIERLTILKEEDGDAGKEEDART
RIIRRAALEFEDGMYANLGIGIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADL
INAGKQTVTVLPGGCFFASDDSFAMIRGGHIQLTMLGAMQVSKYGDLANWMIPGKKVKGM
GGAMDLVSSQKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKE
LTLRELWEGLTVDDIKKSTGCAFAVSPNLRPMQQVAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYC2	1.000	1.000	0.000	517	1.000	1.000	Q9BYC2.pdb.gz	SCOT2_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT2 PE=2 SV=2
2	AFDB:Q9ESL0	0.928	0.923	6.640E-89	520	0.750	0.746	Q9ESL0.pdb.gz	SCO2B_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 2B, mitochondrial OS=Mus musculus OX=10090 GN=Oxct2b PE=2 SV=1
3	AFDB:A0A024R040	0.925	0.920	2.485E-88	520	0.747	0.742	A0A024R040.pdb.gz	A0A024R040_HUMAN Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Homo sapiens OX=9606 GN=OXCT1 PE=2 SV=1
4	AFDB:Q29551	0.949	0.944	1.496E-87	520	0.752	0.748	Q29551.pdb.gz	SCOT1_PIG Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa OX=9823 GN=OXCT1 PE=1 SV=2
5	PDB:1m3eB	0.904	0.988	4.679E-81	473	0.714	0.780	1m3eB.pdb.gz
6	PDB:1opeA	0.870	0.993	8.158E-77	453	0.689	0.786	1opeA.pdb.gz
7	AFDB:Q9W058	0.934	0.936	2.908E-75	516	0.571	0.572	Q9W058.pdb.gz	SCOT_DROME Succinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SCOT PE=1 SV=1
8	AFDB:Q54JD9	0.922	0.936	7.928E-75	509	0.578	0.587	Q54JD9.pdb.gz	SCOT_DICDI Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=oxct1 PE=3 SV=1
9	AFDB:Q09450	0.948	0.941	7.580E-72	521	0.549	0.545	Q09450.pdb.gz	SCOT_CAEEL Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=C05C10.3 PE=3 SV=1
10	PDB:4kgbA	0.881	0.977	1.530E-71	466	0.540	0.599	4kgbA.pdb.gz
11	PDB:1o9lB	0.818	0.994	3.633E-70	425	0.636	0.774	1o9lB.pdb.gz	Succinate:Coenzyme-A Transferase Deficiency: A Structural View of Pathogenic Mutations
12	AFDB:Q386P1	0.902	0.945	2.083E-68	493	0.480	0.503	Q386P1.pdb.gz	Q386P1_TRYB2 Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0290 PE=1 SV=1
13	PDB:6lp1C	0.883	0.973	5.234E-65	469	0.472	0.520	6lp1C.pdb.gz	The ASCT/SCS cycle fuels mitochondrial ATP and acetate production in Trypanosoma brucei.
14	AFDB:G8BJM6	0.922	0.940	9.703E-65	507	0.474	0.483	G8BJM6.pdb.gz	G8BJM6_CANPC Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=OSC1 PE=3 SV=1
15	PDB:2ahuA	0.708	0.711	8.702E-32	515	0.211	0.212	2ahuA.pdb.gz
16	AFDB:F1CYZ5	0.711	0.702	9.026E-32	524	0.230	0.227	F1CYZ5.pdb.gz	CARA_ACEWO Caffeate CoA-transferase OS=Acetobacterium woodii OX=33952 GN=carA PE=1 SV=1
17	PDB:3rrlA	0.438	0.976	1.228E-27	230	0.238	0.535	3rrlA.pdb.gz
18	PDB:3rrlB	0.389	0.958	5.912E-25	207	0.221	0.551	3rrlB.pdb.gz
19	PDB:5dbnF	0.395	0.938	6.360E-24	214	0.188	0.453	5dbnF.pdb.gz
20	PDB:4eu5A	0.535	0.539	2.763E-13	513	0.122	0.123	4eu5A.pdb.gz	Crystal Structures of Acetobacter aceti Succinyl-Coenzyme A (CoA):Acetate CoA-Transferase Reveal Specificity Determinants and Illustrate the Mechanism Used by Class I CoA-Transferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R040	0.0	804	520	0.747	0.742	A0A024R040_HUMAN Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Homo sapiens OX=9606 GN=OXCT1 PE=2 SV=1
2	B2GV06	0.0	796	520	0.743	0.738	SCOT1_RAT Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Oxct1 PE=1 SV=1
3	P55809	0.0	804	520	0.747	0.742	SCOT1_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1
4	Q09450	0.0	579	521	0.549	0.545	SCOT_CAEEL Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=C05C10.3 PE=3 SV=1
5	Q29551	0.0	795	520	0.735	0.731	SCOT1_PIG Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa OX=9823 GN=OXCT1 PE=1 SV=2
6	Q54JD9	0.0	606	509	0.584	0.593	SCOT_DICDI Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=oxct1 PE=3 SV=1
7	Q9BYC2	0.0	1060	517	1.000	1.000	SCOT2_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT2 PE=2 SV=2
8	Q9D0K2	0.0	791	520	0.733	0.729	SCOT1_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Oxct1 PE=1 SV=1
9	Q9ESL0	0.0	779	520	0.735	0.731	SCO2B_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 2B, mitochondrial OS=Mus musculus OX=10090 GN=Oxct2b PE=2 SV=1
10	Q9JJN4	0.0	783	520	0.739	0.735	SCO2A_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 2A, mitochondrial OS=Mus musculus OX=10090 GN=Oxct2a PE=2 SV=2
11	Q9W058	0.0	615	516	0.563	0.564	SCOT_DROME Succinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SCOT PE=1 SV=1
12	Q386P1	5.78e-170	491	493	0.474	0.497	Q386P1_TRYB2 Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0290 PE=1 SV=1
13	G8BJM6	2.12e-162	472	507	0.484	0.493	G8BJM6_CANPC Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=OSC1 PE=3 SV=1
14	P56006	4.88e-83	259	232	0.242	0.539	SCOA_HELPY Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=scoA PE=1 SV=1
15	Q9I2B0	1.77e-82	258	232	0.267	0.595	Q9I2B0_PSEAE 3-oxoadipate CoA-transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=dhcA PE=3 SV=1
16	P9WPW3	2.32e-75	239	218	0.230	0.546	SCOB_MYCTU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=scoB PE=1 SV=1
17	P56007	4.26e-73	232	207	0.221	0.551	SCOB_HELPY Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=scoB PE=1 SV=1
18	Q9I2A9	7.40e-64	209	218	0.201	0.477	Q9I2A9_PSEAE 3-oxoadipate CoA-transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=dhcB PE=3 SV=1
19	P76459	1.45e-56	190	216	0.190	0.454	ATOA_ECOLI Acetate CoA-transferase subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=atoA PE=1 SV=1
20	P33752	4.06e-43	154	218	0.155	0.367	CTFA_CLOAB Acetoacetyl-CoA:acetate/butyrate CoA transferase alpha subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=ctfA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13336 AcetylCoA_hyd_C	31	15.9	Acetyl-CoA hydrolase/transferase C-terminal domain
2	PF01144 CoA_trans	3.8e-119	407.4	Coenzyme A transferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361914

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265838	0.967	Acetyl-CoA acetyltransferase, mitochondrial
2	9606.ENSP00000296424	0.957	3-hydroxybutyrate dehydrogenase type 2
3	9606.ENSP00000376184	0.955	D-beta-hydroxybutyrate dehydrogenase, mitochondrial
4	9606.ENSP00000356015	0.949	Acetyl-CoA acetyltransferase, cytosolic
5	9606.ENSP00000363614	0.941	Hydroxymethylglutaryl-CoA lyase, mitochondrial
6	9606.ENSP00000381654	0.923	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
7	9606.ENSP00000358414	0.922	Hydroxymethylglutaryl-CoA synthase, mitochondrial
8	9606.ENSP00000322706	0.920	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
9	9606.ENSP00000231887	0.915	Peroxisomal bifunctional enzyme
10	9606.ENSP00000196371	0.890	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
11	9606.ENSP00000324842	0.865	Acetoacetyl-CoA synthetase
12	9606.ENSP00000285093	0.863	3-ketoacyl-CoA thiolase, mitochondrial
13	9606.ENSP00000333664	0.859	3-ketoacyl-CoA thiolase, peroxisomal
14	9606.ENSP00000325136	0.847	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
15	9606.ENSP00000452762	0.821	Electron transfer flavoprotein subunit alpha, mitochondrial
16	9606.ENSP00000361852	0.814	Transmembrane and coiled-coil domains 2
17	9606.ENSP00000361915	0.810	Bone morphogenetic protein 8B
18	9606.ENSP00000389813	0.795	Acyl-CoA dehydrogenase family member 10
19	9606.ENSP00000346173	0.785	Electron transfer flavoprotein subunit beta
20	9606.ENSP00000416583	0.755	Deoxyribose-phosphate aldolase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008260	1.000	succinyl-CoA:3-oxo-acid CoA-transferase activity
GO:0005515	0.996	protein binding
GO:0042802	0.604	identical protein binding
GO:0046983	0.445	protein dimerization activity
GO:0042803	0.406	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0044281	0.983	small molecule metabolic process
GO:0071704	0.659	organic substance metabolic process
GO:0044238	0.552	primary metabolic process
GO:0006091	0.422	generation of precursor metabolites and energy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.956	mitochondrial matrix
GO:0005634	0.591	nucleus
GO:0042995	0.418	cell projection
GO:0031981	0.387	nuclear lumen
GO:0120025	0.316	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24564	1.000	a 3-oxo acid + succinyl-CoA = a 3-oxoacyl-CoA + succinate
EC:2.8.3.5	1.000	3-oxoacid CoA-transferase.

[back to server]