StarFunc result for job id Q9BYE0

User Input

>input (225 residues)
MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILE
FAVGYLRERSRVEPPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFS
ALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPVHQGHPSPRCAWSPSLC
SPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPLPPPPAFWRPWP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BKT2	0.659	0.659	1.191E-30	225	0.920	0.920	Q8BKT2.pdb.gz	HES7_MOUSE Transcription factor HES-7 OS=Mus musculus OX=10090 GN=Hes7 PE=1 SV=1
2	AFDB:Q504H7	0.324	0.324	3.210E-8	225	0.302	0.302	Q504H7.pdb.gz
3	AFDB:Q9HCC6	0.303	0.308	1.509E-6	221	0.338	0.344	Q9HCC6.pdb.gz	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
4	AFDB:A7MCR9	0.300	0.236	4.665E-6	291	0.311	0.241	A7MCR9.pdb.gz
5	AFDB:O57337	0.302	0.240	7.425E-6	290	0.271	0.210	O57337.pdb.gz	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
6	AFDB:Q90Z12	0.320	0.262	1.035E-5	281	0.298	0.238	Q90Z12.pdb.gz	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
7	AFDB:Q90468	0.297	0.209	1.349E-5	334	0.262	0.177	Q90468.pdb.gz
8	AFDB:F1QI81	0.305	0.310	1.442E-5	221	0.267	0.271	F1QI81.pdb.gz	F1QI81_DANRE Hairy-related 8a OS=Danio rerio OX=7955 GN=her-8a PE=4 SV=2
9	AFDB:Q6IRB2	0.334	0.287	1.760E-5	267	0.289	0.243	Q6IRB2.pdb.gz	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
10	AFDB:P35428	0.283	0.230	6.639E-5	282	0.262	0.209	P35428.pdb.gz	HES1_MOUSE Transcription factor HES-1 OS=Mus musculus OX=10090 GN=Hes1 PE=1 SV=1
11	PDB:6jcxF	0.128	0.147	4.366	186	0.107	0.129	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
12	PDB:4v6wAN	0.095	0.133	4.665	150	0.058	0.087	4v6wAN.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:8eaue	0.109	0.246	5.694	72	0.044	0.139	8eaue.pdb.gz
14	PDB:6ke6RV	0.120	0.127	6.084	190	0.067	0.079	6ke6RV.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
15	PDB:7fbyA	0.101	0.137	6.084	153	0.036	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:7r72w	0.125	0.147	6.502	189	0.102	0.122	7r72w.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
17	PDB:5apnh	0.106	0.181	6.948	119	0.071	0.134	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:7pzyO	0.093	0.121	6.948	150	0.036	0.053	7pzyO.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
19	PDB:3ik7A	0.158	0.160	7.425	221	0.053	0.054	3ik7A.pdb.gz	Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.
20	PDB:7r04A	0.116	0.019	7.425	2326	0.098	0.009	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BYE0	3.40e-156	433	225	1.000	1.000	HES7_HUMAN Transcription factor HES-7 OS=Homo sapiens OX=9606 GN=HES7 PE=1 SV=2
2	Q8BKT2	2.54e-118	337	225	0.920	0.920	HES7_MOUSE Transcription factor HES-7 OS=Mus musculus OX=10090 GN=Hes7 PE=1 SV=1
3	Q90467	5.73e-22	91.7	205	0.324	0.356	Q90467_DANRE DNA-binding protein OS=Danio rerio OX=7955 GN=her-5 PE=2 SV=1
4	Q8UW74	9.55e-19	82.4	180	0.200	0.250	HE71A_XENLA Transcription factor HES-7.1-A OS=Xenopus laevis OX=8355 GN=hes7.1-a PE=1 SV=1
5	Q8UW72	2.90e-18	80.9	180	0.200	0.250	HE71B_XENLA Transcription factor HES-7.1-B OS=Xenopus laevis OX=8355 GN=hes7.1-b PE=2 SV=1
6	Q90463	6.87e-16	77.0	328	0.262	0.180	Q90463_DANRE HER-1 protein OS=Danio rerio OX=7955 GN=HER-1 PE=1 SV=1
7	Q9DF41	1.30e-14	73.2	291	0.200	0.155	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1
8	Q9HCC6	1.48e-14	72.0	221	0.240	0.244	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
9	Q90Z12	2.16e-14	72.4	281	0.244	0.196	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
10	Q00P32	3.35e-14	70.5	191	0.276	0.325	HES2_XENLA Transcription factor HES-2 OS=Xenopus laevis OX=8355 GN=hes2 PE=1 SV=2
11	Q03062	9.40e-14	68.6	166	0.196	0.265	HES5_RAT Transcription factor HES-5 OS=Rattus norvegicus OX=10116 GN=Hes5 PE=2 SV=1
12	Q6W4T8	1.40e-13	70.1	274	0.147	0.120	Q6W4T8_DANRE Hairy-related 11 OS=Danio rerio OX=7955 GN=him PE=2 SV=1
13	Q90VV1	2.16e-13	69.7	277	0.169	0.137	HES4B_XENLA Transcription factor HES-4-B OS=Xenopus laevis OX=8355 GN=hes4-b PE=1 SV=1
14	Q6XLQ0	3.34e-13	69.3	290	0.200	0.155	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
15	Q6IRB2	3.54e-13	68.9	267	0.196	0.165	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
16	O57337	5.01e-13	68.9	290	0.200	0.155	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
17	P70120	7.12e-13	66.2	167	0.196	0.263	HES5_MOUSE Transcription factor HES-5 OS=Mus musculus OX=10090 GN=Hes5 PE=1 SV=1
18	Q6PBX3	1.05e-12	67.8	270	0.164	0.137	Q6PBX3_DANRE Hairy-related 6 OS=Danio rerio OX=7955 GN=HER-6 PE=2 SV=1
19	Q5TA89	1.22e-12	65.9	166	0.196	0.265	HES5_HUMAN Transcription factor HES-5 OS=Homo sapiens OX=9606 GN=HES5 PE=2 SV=1
20	A0A8I5ZYX7	1.31e-12	68.6	617	0.222	0.081	A0A8I5ZYX7_RAT Hes-related family bHLH transcription factor with YRPW motif 1 OS=Rattus norvegicus OX=10116 GN=Hey1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1e-08	46.3	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000446205

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345206	0.953	Recombining binding protein suppressor of hairless
2	9606.ENSP00000367125	0.893	Probable G-protein coupled receptor 153
3	9606.ENSP00000342392	0.826	Mesoderm posterior protein 2
4	9606.ENSP00000222725	0.794	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
5	9606.ENSP00000314879	0.771	Hydroperoxide isomerase ALOXE3
6	9606.ENSP00000205143	0.758	Delta-like protein 3
7	9606.ENSP00000378650	0.735	T-box transcription factor TBX6
8	9606.ENSP00000323516	0.682	Urotensin-2 receptor
9	9606.ENSP00000281047	0.661	Mesogenin-1
10	9606.ENSP00000277541	0.645	Neurogenic locus notch homolog protein 1
11	9606.ENSP00000314480	0.630	Homeobox protein unc-4 homolog
12	9606.ENSP00000355718	0.622	Delta-like protein 1
13	9606.ENSP00000362298	0.586	Sphingosine-1-phosphate lyase 1
14	9606.ENSP00000345001	0.578	CREB-regulated transcription coactivator 1
15	9606.ENSP00000358703	0.574	Protein ripply2
16	9606.ENSP00000361373	0.574	Krueppel-like factor 17
17	9606.ENSP00000326630	0.567	Zinc finger protein ZFPM1
18	9606.ENSP00000251287	0.563	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
19	9606.ENSP00000176183	0.560	Dopamine receptor D4
20	9606.ENSP00000263269	0.538	Glutamate receptor ionotropic, NMDA 2D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.997	protein binding
GO:0000981	0.995	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.980	transcription cis-regulatory region binding
GO:0000977	0.973	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001217	0.946	DNA-binding transcription repressor activity
GO:0001227	0.942	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048856	0.982	anatomical structure development
GO:0009987	0.978	cellular process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0080090	0.957	regulation of primary metabolic process
GO:0031323	0.955	regulation of cellular metabolic process
GO:0051171	0.946	regulation of nitrogen compound metabolic process
GO:0048519	0.945	negative regulation of biological process
GO:0048523	0.942	negative regulation of cellular process
GO:0019219	0.940	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.929	regulation of biosynthetic process
GO:0032501	0.928	multicellular organismal process
GO:0051252	0.928	regulation of RNA metabolic process
GO:0010468	0.918	regulation of gene expression
GO:0006355	0.898	regulation of DNA-templated transcription
GO:0010605	0.849	negative regulation of macromolecule metabolic process
GO:0006357	0.849	regulation of transcription by RNA polymerase II
GO:0050896	0.766	response to stimulus
GO:0045892	0.754	negative regulation of DNA-templated transcription
GO:0007275	0.726	multicellular organism development
GO:0051716	0.674	cellular response to stimulus
GO:0023052	0.666	signaling
GO:0007154	0.664	cell communication
GO:0007165	0.616	signal transduction
GO:0048731	0.612	system development
GO:0009653	0.503	anatomical structure morphogenesis
GO:0007166	0.424	cell surface receptor signaling pathway
GO:0007219	0.326	Notch signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.887	intracellular organelle lumen
GO:0005654	0.834	nucleoplasm
GO:0005737	0.348	cytoplasm
GO:0032991	0.334	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]