StarFunc result for job id Q9BYE9

User Input

>input (1310 residues)
MAQLWLSCFLLPALVVSVAANVAPKFLANMTSVILPEDLPVGAQAFWLVAEDQDNDPLTY
GMSGPNAYFFAVTPKTGEVKLASALDYETLYTFKVTISVSDPYIQVQREMLVIVEDRNDN
APVFQNTAFSTSINETLPVGSVVFSVLAVDKDMGSAGMVVYSIEKVIPSTGDSEHLFRIL
ANGSIVLNGSLSYNNKSAFYQLELKACDLGGMYHNTFTIQCSLPVFLSISVVDQPDLDPQ
FVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVN
GSLDREQLLEADEEVQLQVTATETHLNIYGQEAKVSIWVTVRVMDVNDHKPEFYNCSLPA
CTFTPEEAQVNFTGYVDEHASPRIPIDDLTMVVYDPDKGSNGTFLLSLGGPDAEAFSVSP
ERAVGSASVQVLVRVSALVDYERQTAMAVQVVATDSVSQNFSVAMVTIHLRDINDHRPTF
PQSLYVLTVPEHSATGSVVTDSIHATDPDTGAWGQITYSLLPGNGADLFQVDPVSGTVTV
RNGELLDRESQAVYYLTLQATDGGNLSSSTTLQIHLLDINDNAPVVSGSYNIFVQEEEGN
VSVTIQAHDNDEPGTNNSRLLFNLLPGPYSHNFSLDPDTGLLRNLGPLDREAIDPALEGR
IVLTVLVSDCGEPVLGTKVNVTITVEDINDNLPIFNQSSYNFTVKEEDPGVLVGVVKAWD
ADQTEANNRISFSLSGSGANYFMIRGLVLGAGWAEGYLRLPPDVSLDYETQPVFNLTVSA
ENPDPQGGETIVDVCVNVKDVNDNPPTLDVASLRGIRVAENGSQHGQVAVVVASDVDTSA
QLEIQLVNILCTKAGVDVGSLCWGWFSVAANGSVYINQSKAIDYEACDLVTLVVRACDLA
TDPGFQAYSNNGSLLITIEDVNDNAPYFLPENKTFVIIPELVLPNREVASVRARDDDSGN
NGVILFSILRVDFISKDGATIPFQGVFSIFTSSEADVFAGSIQPVTSLDSTLQGTYQVTV
QARDRPSLGPFLEATTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTTVY
IVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVLGS
QESQESDLSKQLISVIIGLGVALLLVLVIMTMAFVCVRKSYNRKLQAMKAAKEARKTAAG
VMPSAPAIPGTNMYNTERANPMLNLPNKDLGLEYLSPSNDLDSVSVNSLDDNSVDVDKNS
QEIKEHRPPHTPPEPDPEPLSVVLLGRQAGASGQLEGPSYTNAGLDTTDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYE9	1.000	1.000	0.000	1310	1.000	1.000	Q9BYE9.pdb.gz	CDHR2_HUMAN Cadherin-related family member 2 OS=Homo sapiens OX=9606 GN=CDHR2 PE=1 SV=2
2	AFDB:Q8VHP6	0.254	0.361	3.206E-56	859	0.161	0.246	Q8VHP6.pdb.gz	CDHR1_MOUSE Cadherin-related family member 1 OS=Mus musculus OX=10090 GN=Cdhr1 PE=1 SV=1
3	AFDB:Q96JP9	0.288	0.420	5.227E-56	859	0.155	0.236	Q96JP9.pdb.gz	CDHR1_HUMAN Cadherin-related family member 1 OS=Homo sapiens OX=9606 GN=CDHR1 PE=1 SV=2
4	AFDB:Q9VJB6	0.206	0.159	7.407E-47	1799	0.152	0.111	Q9VJB6.pdb.gz	CADN2_DROME Putative neural-cadherin 2 OS=Drosophila melanogaster OX=7227 GN=CadN2 PE=2 SV=3
5	AFDB:Q91XY7	0.272	0.369	7.233E-42	932	0.158	0.222	Q91XY7.pdb.gz	Q91XY7_MOUSE Protocadherin gamma A12 OS=Mus musculus OX=10090 GN=Pcdhga12 PE=1 SV=1
6	AFDB:Q9Y5G9	0.274	0.361	1.661E-41	962	0.159	0.216	Q9Y5G9.pdb.gz	PCDG4_HUMAN Protocadherin gamma-A4 OS=Homo sapiens OX=9606 GN=PCDHGA4 PE=1 SV=2
7	AFDB:Q91XZ0	0.285	0.390	2.121E-41	931	0.156	0.219	Q91XZ0.pdb.gz	Q91XZ0_MOUSE Protocadherin gamma A1 OS=Mus musculus OX=10090 GN=Pcdhga1 PE=1 SV=1
8	AFDB:Q91XY2	0.142	0.193	2.986E-41	932	0.162	0.227	Q91XY2.pdb.gz	Q91XY2_MOUSE Protocadherin gamma A6 OS=Mus musculus OX=10090 GN=Pcdhga6 PE=1 SV=1
9	AFDB:Q9Y5G3	0.281	0.384	2.986E-41	927	0.157	0.222	Q9Y5G3.pdb.gz	PCDGD_HUMAN Protocadherin gamma-B1 OS=Homo sapiens OX=9606 GN=PCDHGB1 PE=1 SV=1
10	AFDB:Q91XX9	0.169	0.229	4.415E-41	932	0.163	0.230	Q91XX9.pdb.gz	Q91XX9_MOUSE Protocadherin gamma A9 OS=Mus musculus OX=10090 GN=Pcdhga9 PE=1 SV=1
11	PDB:7sqcO0	0.107	0.117	3.307E-19	1140	0.075	0.086	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.091	0.145	2.789E-14	721	0.071	0.129	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:1e07A	0.100	0.166	8.176E-14	642	0.064	0.131	1e07A.pdb.gz
14	PDB:5a42A	0.080	0.068	8.545E-13	1597	0.097	0.080	5a42A.pdb.gz
15	PDB:7q5zA	0.094	0.093	1.146E-12	1344	0.070	0.068	7q5zA.pdb.gz
16	PDB:5oj2B	0.093	0.143	5.216E-12	692	0.069	0.130	5oj2B.pdb.gz
17	PDB:7vonA	0.089	0.087	6.040E-12	1399	0.082	0.076	7vonA.pdb.gz
18	PDB:6velC	0.123	0.617	1.140E-11	209	0.045	0.282	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
19	PDB:7q1yA	0.090	0.087	8.889E-11	1374	0.069	0.066	7q1yA.pdb.gz
20	PDB:7nycA	0.085	0.077	9.802E-11	1542	0.068	0.058	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BYE9	0.0	2666	1310	1.000	1.000	CDHR2_HUMAN Cadherin-related family member 2 OS=Homo sapiens OX=9606 GN=CDHR2 PE=1 SV=2
2	Q9VFH5	4.20e-93	334	1981	0.244	0.161	Q9VFH5_DROME Cadherin 88C OS=Drosophila melanogaster OX=7227 GN=Cad88C PE=4 SV=3
3	Q9H251	1.29e-81	299	3354	0.244	0.095	CAD23_HUMAN Cadherin-23 OS=Homo sapiens OX=9606 GN=CDH23 PE=1 SV=2
4	P58365	1.48e-79	292	3317	0.251	0.099	CAD23_RAT Cadherin-23 OS=Rattus norvegicus OX=10116 GN=Cdh23 PE=2 SV=1
5	Q99PF4	2.10e-79	292	3354	0.241	0.094	CAD23_MOUSE Cadherin-23 OS=Mus musculus OX=10090 GN=Cdh23 PE=1 SV=2
6	Q6QQE1	6.54e-76	281	3366	0.227	0.089	Q6QQE1_DANRE Cadherin 23 OS=Danio rerio OX=7955 GN=cdh23 PE=1 SV=1
7	Q96JP9	2.92e-68	250	859	0.169	0.257	CDHR1_HUMAN Cadherin-related family member 1 OS=Homo sapiens OX=9606 GN=CDHR1 PE=1 SV=2
8	Q8VHP6	4.17e-67	246	859	0.172	0.262	CDHR1_MOUSE Cadherin-related family member 1 OS=Mus musculus OX=10090 GN=Cdhr1 PE=1 SV=1
9	Q24292	6.63e-67	252	3503	0.223	0.083	DS_DROME Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3
10	X2J8E9	8.36e-67	252	3556	0.223	0.082	X2J8E9_DROME Dachsous, isoform B OS=Drosophila melanogaster OX=7227 GN=ds PE=4 SV=1
11	Q6V0I7	1.67e-65	248	4981	0.185	0.049	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
12	Q9VVG0	2.16e-63	240	1820	0.215	0.154	Q9VVG0_DROME Cadherin 74A, isoform A OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
13	Q8IGX4	3.73e-62	236	1820	0.214	0.154	Q8IGX4_DROME RE10062p OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
14	F2Z4A3	3.70e-61	234	4590	0.189	0.054	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
15	A0A087WRT4	3.94e-61	234	4602	0.189	0.054	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2
16	A0A1L1SQU7	4.26e-61	234	4645	0.189	0.053	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
17	Q9QXA3	5.69e-61	233	4587	0.188	0.054	Q9QXA3_MOUSE Fat 1 cadherin (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
18	Q14517	2.46e-60	231	4588	0.229	0.065	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
19	Q9WU10	6.95e-60	230	4589	0.190	0.054	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
20	Q2PZL6	8.34e-59	226	4981	0.178	0.047	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	4.2e-96	326.9	Cadherin domain
2	PF08266 Cadherin_2	10	17.4	Cadherin-like
3	PF16184 Cadherin_3	1.4e-05	36.3	Cadherin-like
4	PF17803 Cadherin_4	0.1	24.5	Bacterial cadherin-like domain
5	PF15065 NCU-G1	2.2e+02	12.3	Lysosomal transcription factor, NCU-G1
6	PF14143 YrhC	3.8e+02	12.6	YrhC-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351118	0.985	Cadherin-related family member 5
2	9606.ENSP00000005226	0.849	Harmonin
3	9606.ENSP00000415090	0.840	Unconventional myosin-VIIb
4	9606.ENSP00000305839	0.742	G protein-regulated inducer of neurite outgrowth 1
5	9606.ENSP00000308772	0.719	Ankyrin repeat and SAM domain-containing protein 4B
6	9606.ENSP00000357900	0.704	CUB and zona pellucida-like domain-containing protein 1
7	9606.ENSP00000304376	0.679	Ras-related protein Rab-24
8	9606.ENSP00000351484	0.665	N-acetylated-alpha-linked acidic dipeptidase-like protein
9	9606.ENSP00000395929	0.662	Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific
10	9606.ENSP00000264605	0.645	Melanophilin
11	9606.ENSP00000354671	0.596	Microtubule-associated serine/threonine-protein kinase 2
12	9606.ENSP00000391409	0.580	Cadherin-related family member 4
13	9606.ENSP00000376807	0.523	Dipeptidase 1
14	9606.ENSP00000299440	0.520	V(D)J recombination-activating protein 1
15	9606.ENSP00000304437	0.520	Protein very KIND
16	9606.ENSP00000369473	0.519	NEDD4 binding protein 2 like 1
17	9606.ENSP00000234701	0.508	Calcium-activated chloride channel regulator 1
18	9606.ENSP00000410083	0.503	Vezatin
19	9606.ENSP00000367059	0.501	Espin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	1.000	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.944	biological regulation
GO:0050789	0.881	regulation of biological process
GO:0050794	0.853	regulation of cellular process
GO:0007155	0.807	cell adhesion
GO:0032502	0.665	developmental process
GO:0098609	0.663	cell-cell adhesion
GO:0016043	0.639	cellular component organization
GO:0050896	0.581	response to stimulus
GO:0034109	0.505	homotypic cell-cell adhesion
GO:0048856	0.493	anatomical structure development
GO:0032501	0.412	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005886	0.996	plasma membrane
GO:0005576	0.963	extracellular region
GO:0120025	0.958	plasma membrane bounded cell projection
GO:0031982	0.949	vesicle
GO:0043230	0.946	extracellular organelle
GO:0005615	0.918	extracellular space
GO:1903561	0.902	extracellular vesicle
GO:0098590	0.869	plasma membrane region
GO:0070062	0.851	extracellular exosome
GO:0098862	0.830	cluster of actin-based cell projections
GO:0045177	0.819	apical part of cell
GO:0031253	0.777	cell projection membrane
GO:0043231	0.745	intracellular membrane-bounded organelle
GO:0005737	0.696	cytoplasm
GO:0098858	0.558	actin-based cell projection
GO:0005903	0.542	brush border
GO:0005902	0.540	microvillus
GO:0031526	0.381	brush border membrane
GO:0031528	0.369	microvillus membrane
GO:0016324	0.364	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]