StarFunc result for job id Q9BYG0

User Input

>input (378 residues)
MRMLVSGRRVKKWQLIIQLFATCFLASLMFFWEPIDNHIVSHMKSYSYRYLINSYDFVND
TLSLKHTSAGPRYQYLINHKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNENYVRSQ
LNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWAN
TYCPHAKFLMTADDDIFIHMPNLIEYLQSLEQIGVQDFWIGRVHRGAPPIRDKSSKYYVS
YEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQDH
VFFSGEGKTPYHPCIYEKMMTSHGHLEDLQDLWKNATDPKVKTISKGFFGQIYCRLMKII
LLCKISYVDTYPCRAAFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYG0	1.000	1.000	1.670E-81	378	1.000	1.000	Q9BYG0.pdb.gz	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
2	AFDB:Q99NB2	0.913	0.916	2.924E-70	377	0.796	0.798	Q99NB2.pdb.gz	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
3	AFDB:O43825	0.710	0.641	5.704E-30	422	0.265	0.237	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
4	AFDB:O54904	0.667	0.771	3.179E-29	326	0.257	0.298	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
5	AFDB:Q6ZMB0	0.652	0.642	1.880E-28	384	0.265	0.260	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
6	AFDB:Q8K0J2	0.646	0.616	2.133E-27	397	0.270	0.257	Q8K0J2.pdb.gz	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
7	AFDB:Q8NFL0	0.642	0.606	3.044E-27	401	0.259	0.244	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
8	AFDB:Q9Y2A9	0.652	0.662	3.044E-27	372	0.262	0.266	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
9	AFDB:Q9Y2C3	0.647	0.782	3.635E-27	310	0.254	0.310	Q9Y2C3.pdb.gz	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
10	AFDB:O75752	0.677	0.770	1.696E-26	331	0.228	0.260	O75752.pdb.gz	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
11	PDB:7jhiC	0.660	0.751	2.856E-26	331	0.230	0.263	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:6fxrA	0.327	0.196	6.853E-5	700	0.103	0.056	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:4fixA	0.332	0.215	2.112E-4	629	0.087	0.052	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
14	PDB:4y63A	0.349	0.445	3.198E-4	282	0.063	0.085	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
15	PDB:7x8kB	0.269	0.275	4.300E-4	367	0.066	0.068	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
16	PDB:3r2wC	0.253	0.220	5.782E-4	450	0.090	0.076	3r2wC.pdb.gz
17	PDB:4hg6A	0.386	0.214	5.782E-4	747	0.124	0.063	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
18	PDB:2gamC	0.362	0.365	7.776E-4	374	0.058	0.059	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
19	PDB:5l6vI	0.278	0.266	8.250E-4	400	0.069	0.065	5l6vI.pdb.gz	Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
20	PDB:7d72A	0.251	0.237	1.109E-3	407	0.061	0.057	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BGY6	0.0	651	376	0.794	0.798	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
2	Q99NB2	0.0	664	377	0.796	0.798	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
3	Q9BYG0	0.0	797	378	1.000	1.000	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
4	Q8K0J2	3.84e-53	182	397	0.270	0.257	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
5	Q8NFL0	8.48e-53	182	401	0.265	0.249	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
6	Q6ZMB0	1.29e-51	178	384	0.262	0.258	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
7	O43825	2.51e-50	176	422	0.243	0.218	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
8	O54905	3.60e-49	173	422	0.238	0.213	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
9	O54904	5.52e-48	167	326	0.251	0.291	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
10	Q9Y5Z6	5.52e-48	167	326	0.251	0.291	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
11	Q9Y2A9	1.70e-46	164	372	0.270	0.274	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
12	Q9Z222	5.64e-46	164	397	0.251	0.239	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
13	Q9C0J1	3.01e-44	159	378	0.241	0.241	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
14	Q9Y2C3	1.46e-43	155	310	0.230	0.281	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
15	Q9NY97	2.01e-43	157	397	0.241	0.229	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
16	Q9JI67	1.87e-41	149	308	0.228	0.279	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
17	O96024	2.79e-38	143	378	0.251	0.251	B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GALT4 PE=1 SV=1
18	Q7Z7M8	7.93e-37	139	397	0.228	0.217	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
19	Q920V1	1.00e-36	137	331	0.209	0.239	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
20	O75752	3.26e-35	133	331	0.204	0.233	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02434 Fringe	0.6	21.1	Fringe-like
2	PF01762 Galactosyl_T	1.3e-43	160.7	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316173

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420161	0.971	Beta-1,4-galactosyltransferase 4
2	9606.ENSP00000414350	0.950	Mucin-20
3	9606.ENSP00000310696	0.949	Beta-1,4-galactosyltransferase 2
4	9606.ENSP00000369055	0.947	Beta-1,4-galactosyltransferase 1
5	9606.ENSP00000485028	0.936	Mucin-13
6	9606.ENSP00000306459	0.933	Beta-1,4-galactosyltransferase 6
7	9606.ENSP00000417498	0.929	Mucin-4
8	9606.ENSP00000485659	0.917	Mucin-5AC
9	9606.ENSP00000381699	0.915	Beta-1,3-galactosyltransferase 5
10	9606.ENSP00000406861	0.913	Mucin-6
11	9606.ENSP00000376456	0.911	Beta-1,3-galactosyltransferase 1
12	9606.ENSP00000407422	0.907	Mucin-7
13	9606.ENSP00000480428	0.907	Beta-1,4-galactosyltransferase 3
14	9606.ENSP00000381008	0.906	Mucin-16
15	9606.ENSP00000436812	0.906	Mucin-5B
16	9606.ENSP00000356404	0.905	Beta-1,3-galactosyltransferase 2
17	9606.ENSP00000484824	0.905	Mucin-1
18	9606.ENSP00000441929	0.904	Mucin-12
19	9606.ENSP00000302716	0.903	Mucin-17
20	9606.ENSP00000311364	0.900	Mucin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048531	1.000	beta-1,3-galactosyltransferase activity
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0005515	0.999	protein binding
GO:0008499	0.994	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:1901564	0.991	organonitrogen compound metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0009058	0.988	biosynthetic process
GO:1901137	0.983	carbohydrate derivative biosynthetic process
GO:1901566	0.978	organonitrogen compound biosynthetic process
GO:0044249	0.977	cellular biosynthetic process
GO:0006643	0.969	membrane lipid metabolic process
GO:0070085	0.934	glycosylation
GO:0032501	0.926	multicellular organismal process
GO:0034645	0.897	cellular macromolecule biosynthetic process
GO:0048856	0.891	anatomical structure development
GO:0007275	0.881	multicellular organism development
GO:0019538	0.817	protein metabolic process
GO:0048731	0.814	system development
GO:0036211	0.786	protein modification process
GO:0007399	0.754	nervous system development
GO:0009100	0.730	glycoprotein metabolic process
GO:1903509	0.699	liposaccharide metabolic process
GO:0046467	0.689	membrane lipid biosynthetic process
GO:0009101	0.653	glycoprotein biosynthetic process
GO:0006486	0.563	protein glycosylation
GO:0006664	0.506	glycolipid metabolic process
GO:0007417	0.400	central nervous system development
GO:0009247	0.353	glycolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]