StarFunc result for job id Q9BYH8

User Input

>input (718 residues)
MIVDKLLDDSRGGEGLRDAAGGCGLMTSPLNLSYFYGASPPAAAPGACDASCSVLGPSAP
GSPGSDSSDFSSASSVSSCGAVESRSRGGARAERQPVEPHMGVGRQQRGPFQGVRVKNSV
KELLLHIRSHKQKASGQAVDDFKTQGVNIEQFRELKNTVSYSGKRKGPDSLSDGPACKRP
ALLHSQFLTPPQTPTPGESMEDVHLNEPKQESSADLLQNIINIKNECSPVSLNTVQVSWL
NPVVVPQSSPAEQCQDFHGGQVFSPPQKCQPFQVRGSQQMIDQASLYQYSPQNQHVEQQP
HYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRESENIANPMQTS
SSVQQQNDAHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQW
QVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNG
QSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSN
QFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQ
MGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQ
YRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYH8	1.000	1.000	1.890E-80	718	1.000	1.000	Q9BYH8.pdb.gz	IKBZ_HUMAN NF-kappa-B inhibitor zeta OS=Homo sapiens OX=9606 GN=NFKBIZ PE=1 SV=1
2	AFDB:Q9EST8	0.531	0.524	2.234E-64	728	0.819	0.808	Q9EST8.pdb.gz	IKBZ_MOUSE NF-kappa-B inhibitor zeta OS=Mus musculus OX=10090 GN=Nfkbiz PE=1 SV=1
3	PDB:8cs9A	0.252	0.231	9.159E-10	796	0.093	0.084	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
4	AFDB:A2ABF9	0.282	0.166	6.909E-9	1267	0.174	0.099	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
5	AFDB:Q9H9B1	0.301	0.175	1.810E-8	1298	0.159	0.088	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
6	PDB:2dvwA	0.278	0.792	2.399E-8	229	0.082	0.258	2dvwA.pdb.gz
7	AFDB:A0A0G2K889	0.288	0.171	4.009E-8	1289	0.167	0.093	A0A0G2K889.pdb.gz	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
8	PDB:5vkqA	0.124	0.063	3.802E-7	1499	0.099	0.047	5vkqA.pdb.gz
9	PDB:6aunA	0.232	0.263	1.452E-6	618	0.084	0.097	6aunA.pdb.gz
10	PDB:1wg0A	0.265	0.699	1.716E-6	243	0.082	0.243	1wg0A.pdb.gz
11	PDB:4oauC	0.235	0.242	2.608E-6	692	0.093	0.097	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
12	PDB:6v9hC	0.255	0.609	3.802E-6	270	0.086	0.230	6v9hC.pdb.gz
13	AFDB:Q54HC6	0.249	0.128	1.887E-5	1460	0.198	0.097	Q54HC6.pdb.gz	ARKA_DICDI Ankyrin repeat-containing protein kinase A OS=Dictyostelium discoideum OX=44689 GN=arkA PE=1 SV=1
14	PDB:6jd6B	0.198	0.674	5.778E-5	192	0.071	0.266	6jd6B.pdb.gz
15	AFDB:A0A140LI88	0.165	0.070	8.168E-5	1857	0.130	0.050	A0A140LI88.pdb.gz	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
16	PDB:6dmwA	0.244	0.275	1.451E-4	631	0.071	0.081	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.
17	PDB:6pqpA	0.210	0.242	3.802E-4	615	0.067	0.078	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
18	AFDB:Q6W2J9	0.163	0.080	1.295E-3	1755	0.134	0.055	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
19	AFDB:Q8CGN4	0.151	0.069	1.468E-3	1759	0.143	0.059	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
20	AFDB:Q8NDZ2	0.142	0.124	8.517E-3	872	0.150	0.124	Q8NDZ2.pdb.gz	SIMC1_HUMAN SUMO-interacting motif-containing protein 1 OS=Homo sapiens OX=9606 GN=SIMC1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JZ23	0.0	1244	601	0.837	1.000	C9JZ23_HUMAN NFKB inhibitor zeta (Fragment) OS=Homo sapiens OX=9606 GN=NFKBIZ PE=1 SV=1
2	Q9BYH8	0.0	1485	718	1.000	1.000	IKBZ_HUMAN NF-kappa-B inhibitor zeta OS=Homo sapiens OX=9606 GN=NFKBIZ PE=1 SV=1
3	Q9EST8	0.0	1134	728	0.820	0.809	IKBZ_MOUSE NF-kappa-B inhibitor zeta OS=Mus musculus OX=10090 GN=Nfkbiz PE=1 SV=1
4	Q8NI38	1.80e-59	205	313	0.175	0.403	IKBD_HUMAN NF-kappa-B inhibitor delta OS=Homo sapiens OX=9606 GN=NFKBID PE=1 SV=1
5	Q2TB02	4.01e-59	204	327	0.175	0.385	IKBD_MOUSE NF-kappa-B inhibitor delta OS=Mus musculus OX=10090 GN=Nfkbid PE=1 SV=2
6	E7FFI8	5.96e-28	121	619	0.134	0.155	E7FFI8_DANRE B-cell lymphoma 3 protein homolog OS=Danio rerio OX=7955 GN=bcl3 PE=4 SV=1
7	P20749	6.63e-27	116	454	0.135	0.214	BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=2
8	Q20KN0	5.09e-25	110	439	0.125	0.205	Q20KN0_CARRO IkB OS=Carcinoscorpius rotundicauda OX=6848 PE=1 SV=1
9	H7C0A2	7.41e-23	102	308	0.131	0.305	H7C0A2_HUMAN BCL3 transcription coactivator (Fragment) OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=1
10	Q9Z2F6	2.89e-22	102	448	0.118	0.190	BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus OX=10090 GN=Bcl3 PE=1 SV=2
11	Q00653	7.08e-22	103	900	0.123	0.098	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
12	Q9WTK5	7.80e-21	100	899	0.118	0.095	NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus OX=10090 GN=Nfkb2 PE=1 SV=1
13	Q04861	8.28e-21	100	983	0.114	0.083	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
14	A0A8I6G6F3	6.02e-20	97.4	902	0.118	0.094	A0A8I6G6F3_RAT Nuclear factor kappa B subunit 2 OS=Rattus norvegicus OX=10116 GN=Nfkb2 PE=1 SV=1
15	Q63369	7.78e-20	95.9	522	0.096	0.132	NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit OS=Rattus norvegicus OX=10116 GN=Nfkb1 PE=1 SV=2
16	P25799	1.73e-18	92.8	971	0.100	0.074	NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus OX=10090 GN=Nfkb1 PE=1 SV=2
17	O00221	1.10e-17	89.0	500	0.109	0.156	IKBE_HUMAN NF-kappa-B inhibitor epsilon OS=Homo sapiens OX=9606 GN=NFKBIE PE=1 SV=3
18	Q7LC14	1.25e-17	87.4	361	0.109	0.216	Q7LC14_HUMAN NFKB inhibitor epsilon OS=Homo sapiens OX=9606 GN=NFKBIE PE=1 SV=1
19	P19838	4.64e-17	88.2	968	0.102	0.075	NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens OX=9606 GN=NFKB1 PE=1 SV=2
20	P25963	1.37e-16	83.6	317	0.096	0.218	IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	5.7e-16	69.4	Ankyrin repeat
2	PF12796 Ank_2	7.6e-23	92.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	4.7e-15	65.0	Ankyrin repeat
4	PF13637 Ank_4	3.8e-17	73.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.7e-07	42.6	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264657	0.971	Signal transducer and activator of transcription 3
2	9606.ENSP00000226574	0.940	Nuclear factor NF-kappa-B p105 subunit
3	9606.ENSP00000384273	0.923	Transcription factor p65
4	9606.ENSP00000442788	0.893	Methylcytosine dioxygenase TET2
5	9606.ENSP00000257787	0.820	Akirin-2
6	9606.ENSP00000301790	0.805	Ca(2+)-independent N-acyltransferase
7	9606.ENSP00000329357	0.789	Transcription factor Sp1
8	9606.ENSP00000362179	0.730	Endoribonuclease ZC3H12A
9	9606.ENSP00000295025	0.723	Proto-oncogene c-Rel
10	9606.ENSP00000481570	0.720	Tumor necrosis factor alpha-induced protein 3
11	9606.ENSP00000263056	0.711	Mitogen-activated protein kinase kinase kinase 8
12	9606.ENSP00000385675	0.673	Interleukin-6
13	9606.ENSP00000448665	0.658	DNA damage-inducible transcript 3 protein
14	9606.ENSP00000221452	0.637	Transcription factor RelB
15	9606.ENSP00000254108	0.631	RNA-binding protein FUS
16	9606.ENSP00000427279	0.605	C-X-C motif chemokine 2
17	9606.ENSP00000358997	0.585	Interleukin-1 receptor-associated kinase 1
18	9606.ENSP00000263341	0.576	Interleukin-1 beta
19	9606.ENSP00000379110	0.569	Growth-regulated alpha protein
20	9606.ENSP00000398698	0.551	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.636	heterocyclic compound binding
GO:0097159	0.635	organic cyclic compound binding
GO:0003677	0.615	DNA binding
GO:0043565	0.548	sequence-specific DNA binding
GO:0003690	0.495	double-stranded DNA binding
GO:1990837	0.494	sequence-specific double-stranded DNA binding
GO:0140110	0.459	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0048518	0.980	positive regulation of biological process
GO:0009987	0.970	cellular process
GO:0032103	0.940	positive regulation of response to external stimulus
GO:0031349	0.936	positive regulation of defense response
GO:0050794	0.924	regulation of cellular process
GO:0050896	0.902	response to stimulus
GO:0010468	0.867	regulation of gene expression
GO:0080090	0.865	regulation of primary metabolic process
GO:0051171	0.865	regulation of nitrogen compound metabolic process
GO:0048522	0.780	positive regulation of cellular process
GO:0031326	0.772	regulation of cellular biosynthetic process
GO:0051716	0.771	cellular response to stimulus
GO:0010556	0.771	regulation of macromolecule biosynthetic process
GO:0051252	0.769	regulation of RNA metabolic process
GO:2001141	0.726	regulation of RNA biosynthetic process
GO:0006355	0.724	regulation of DNA-templated transcription
GO:0009893	0.705	positive regulation of metabolic process
GO:0010604	0.704	positive regulation of macromolecule metabolic process
GO:0050727	0.647	regulation of inflammatory response
GO:0050729	0.613	positive regulation of inflammatory response
GO:0042221	0.583	response to chemical
GO:0071704	0.581	organic substance metabolic process
GO:0044238	0.565	primary metabolic process
GO:0006807	0.516	nitrogen compound metabolic process
GO:0051173	0.486	positive regulation of nitrogen compound metabolic process
GO:0023052	0.485	signaling
GO:0007154	0.485	cell communication
GO:0007165	0.484	signal transduction
GO:0048519	0.483	negative regulation of biological process
GO:0002376	0.462	immune system process
GO:0043170	0.462	macromolecule metabolic process
GO:0045935	0.458	positive regulation of nucleobase-containing compound metabolic process
GO:0044419	0.454	biological process involved in interspecies interaction between organisms
GO:0051239	0.450	regulation of multicellular organismal process
GO:0002682	0.448	regulation of immune system process
GO:0045893	0.446	positive regulation of DNA-templated transcription
GO:0006950	0.444	response to stress
GO:0009607	0.427	response to biotic stimulus
GO:0044237	0.427	cellular metabolic process
GO:0009605	0.418	response to external stimulus
GO:0006357	0.417	regulation of transcription by RNA polymerase II
GO:0010033	0.411	response to organic substance
GO:0048523	0.411	negative regulation of cellular process
GO:0043207	0.405	response to external biotic stimulus
GO:0051707	0.403	response to other organism
GO:0070887	0.402	cellular response to chemical stimulus
GO:0071310	0.380	cellular response to organic substance
GO:0032501	0.372	multicellular organismal process
GO:0032502	0.358	developmental process
GO:0034097	0.356	response to cytokine
GO:0010646	0.330	regulation of cell communication
GO:0023051	0.329	regulation of signaling
GO:0051240	0.317	positive regulation of multicellular organismal process
GO:0002684	0.317	positive regulation of immune system process
GO:0007166	0.317	cell surface receptor signaling pathway
GO:0071345	0.314	cellular response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0005737	0.973	cytoplasm
GO:0099080	0.502	supramolecular complex
GO:0016604	0.488	nuclear body
GO:0035770	0.440	ribonucleoprotein granule
GO:0036464	0.416	cytoplasmic ribonucleoprotein granule
GO:0016607	0.314	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]