StarFunc result for job id Q9BYK8

User Input

>input (2649 residues)
MAVWEAEQLGGLQRGDLLTPPAPDGDGRTAPLGQPPGAQLYCPACLVTCHSQEAFENHCA
SSEHAQMVAFDQALPWEHRSPPPGLSKFELCPKPDLCEYGDACTKAHSAQELQEWVRRTQ
AVELRGQAAWQDGLVPYQERLLAEYQRSSSEVLVLAETLDGVRVTCNQPLMYQAQERKTQ
YSWTFAVHSEEPLLHVALLKQEPGADFSLVAPGLPPGRLYARGERFRVPSSTADFQVGVR
VQAASFGTFEQWVVFDFGRRPVLLQKLGLQLGQGRRPGPCRNLALGHPEEMERWHTGNRH
VVPGVERTAEQTALMAKYKGPALALEFNRSSVASGPISPTNYRQRMHQFLYEEEAAQQQL
VAKLTLRGQVFLKTALQTPALNMLFAPPGALYAEVPVPSSLMPDTDQGFLLGRAVSTALV
APVPAPDNTVFEVRLERRASSEQALWLLLPARCCLALGLQPEARLVLEVQFQIDPMTFRL
WHQAVDTLPEEQLVVPDLPTCALPRPWSVPPLRRGNRKQELAVALIAGWGPGDGRRVPPL
LIYGPFGTGKTYTLAMASLEVIRRPETKVLICTHTNSAADIYIREYFHSHVSGGHPEATP
LRVMYTDRPLSQTDPVTLQYCCLTDDRQAFRPPTRAELARHRVVVTTTSQARELRVPVGF
FSHILIDEAAQMLECEALTPLAYASHGTRLVLAGDHMQVTPRLFSVARARAAEHTLLHRL
FLCYQQETHEVARQSRLVFHENYRCTDAIVSFISRHFYVAKGNPIHARGKVPPHPRHYPL
MFCHVAGSPDRDMSMASWLNLAEIAQVVEKVQEAYNTWPSCWGGREQRCICVVSHGAQVS
ALRQELRRRDLGQVSVGSFEILPGRQFRVVVLSTVHTCQSLLSPGALAPEFFTDARVLNT
VLTRAQSQLVVVGDAVALCSFGACGKLWESFIRECVERHSVCPEGLSMEQVEQGVAQRRR
WPPRGTQAGAAGNWEAAPEPVGDLAEEQAAVVTAMVKAEPGDEALSPASRDITATTAQTE
AAAAPAGDAVKEDVVPGACAAGAAAAAGVESTEAEDAEADFWPWDGELNADDAILRELLD
ESQKVMVTVGEDGLLDTVARPESLQQARLYENLPPAALRKLLHAEPERYRHCSFVPETFE
RASAIPLDDASSGPIQVRGRLDCGMAFAGDEVLVQLLSGDKAPEGRLRGRVLGVLKRKRH
ELAFVCRMDTWDPRIMVPINGSVTKIFVAELKDPSQVPIYSLRKGRLQRVGLERLTAEAR
HSRLFWVQIVLWRQGFYYPLGIVREVLPEASTWEQGLRILGLEYSLRVPPSDQATITKVL
QKYHTELGRVAGRREDCRAFLTFTVDPQGACNLDDALSVRDLGPRCEVAVHITDVASFVP
RDGVLDVEARRQGAAFYAPGREPVPMLPASLCQDVLSLLPGRDRLAISLFLTMEKASGQL
KSLRFAPSVVQSDRQLSYEEAEEVIRQHPGAGRELPARLDSVDACVVAACYFSRLLRRHR
LRSDCFYEQPDEDGTLGFRAAHIMVKEYMIQFNRLVAEFLVGSECTRTVTPLRWQPAPRS
QQLKALCEKHGDRVPLSLHLGHHLHGGGGSPPDTRLHLLASLWKQVQFAARTQDYEQMVD
LVTTDDMHPFLAPAGRDLRKALERSAFGRCARGHQQQGGHYSLQVDWYTWATSPIRRYLD
VVLQRQILLALGHGGSAYSARDIDGLCQAFSLQHALAQSYQRRARSLHLAVQLKAQPLDK
LGFVVDVEAGSRCFRLLFPSNRETLPDPCPVPYGSLQLAEHPHALAGRPGLRLLWRRRVY
SAQGSSPPLPLPGTVPDPHTLAVETALWKQLLELVELQRWPEAAALIQEKGEASQRRELV
QVQRSHCGHFLEVARELGSGDTLQVQLGTSLQHGFLVPSPQLWTVAPGFSLCLEHVERPG
DCFSGRVYRAPRDRYRDVDEYACVWEPFCALESATGAVAENDSVTLQHLSVSWEASRTPQ
GQLQGAFRLEAAFLEENCADINFSCCYLCIRLEGLPAPTASPRPGPSSLGPGLNVDPGTY
TWVAHGQTQDWDQERRADRQEAPRRVHLFVHHMGMEKVPEEVLRPGTLFTVELLPKQLPD
LRKEEAVRGLEEASPLVTSIALGRPVPQPLCRVIPSRFLERQTYNIPGGRHKLNPSQNVA
VREALEKPFTVIQGPPGTGKTIVGLHIVFWFHKSNQEQVQPGGPPRGEKRLGGPCILYCG
PSNKSVDVLAGLLLRRMELKPLRVYSEQAEASEFPVPRVGSRKLLRKSPREGRPNQSLRS
ITLHHRIRQAPNPYSSEIKAFDTRLQRGELFSREDLVWYKKVLWEARKFELDRHEVILCT
CSCAASASLKILDVRQILVDEAGMATEPETLIPLVQFPQAEKVVLLGDHKQLRPVVKNER
LQNLGLDRSLFERYHEDAHMLDTQYRMHEGICAFPSVAFYKSKLKTWQGLRRPPSVLGHA
GKESCPVIFGHVQGHERSLLVSTDEGNENSKANLEEVAEVVRITKQLTLGRTVEPQDIAV
LTPYNAQASEISKALRREGIAGVAVSSITKSQGSEWRYVLVSTVRTCAKSDLDQRPTKSW
LKKFLGFVVDPNQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLLDFCEAQQTLVPAGQVR
VCRRPTMPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYK8	1.000	1.000	0.000	2649	1.000	1.000	Q9BYK8.pdb.gz	HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens OX=9606 GN=HELZ2 PE=1 SV=6
2	AFDB:P42694	0.233	0.315	8.146E-72	1942	0.123	0.168	P42694.pdb.gz	HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2
3	AFDB:P30771	0.182	0.473	2.680E-39	971	0.072	0.196	P30771.pdb.gz	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1
4	AFDB:Q582F1	0.185	0.548	4.362E-39	842	0.070	0.221	Q582F1.pdb.gz	Q582F1_TRYB2 Regulator of nonsense transcripts 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.50 PE=3 SV=1
5	AFDB:Q9Y2L1	0.199	0.513	1.706E-38	958	0.057	0.157	Q9Y2L1.pdb.gz	RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2
6	AFDB:Q8TF46	0.208	0.487	1.881E-38	1054	0.064	0.161	Q8TF46.pdb.gz	DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens OX=9606 GN=DIS3L PE=1 SV=2
7	AFDB:Q09820	0.189	0.512	4.521E-38	925	0.071	0.203	Q09820.pdb.gz	RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf1 PE=3 SV=2
8	AFDB:O14040	0.215	0.568	6.357E-38	927	0.069	0.197	O14040.pdb.gz	DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis32 PE=1 SV=1
9	AFDB:Q9VYS3	0.183	0.392	7.358E-38	1180	0.071	0.160	Q9VYS3.pdb.gz	RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster OX=7227 GN=Upf1 PE=1 SV=2
10	PDB:4ifdJ	0.210	0.541	2.215E-35	948	0.059	0.164	4ifdJ.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
11	AFDB:Q384R7	0.198	0.499	9.028E-35	972	0.053	0.144	Q384R7.pdb.gz	Q384R7_TRYB2 Exosome complex exonuclease RRP44p homologue OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5380 PE=3 SV=1
12	PDB:5c0wJ	0.205	0.523	7.759E-34	970	0.059	0.160	5c0wJ.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
13	PDB:6h25J	0.194	0.535	3.187E-33	868	0.056	0.172	6h25J.pdb.gz	Distinct and evolutionary conserved structural features of the human nuclear exosome complex.
14	PDB:5g06J	0.210	0.522	8.864E-33	993	0.055	0.148	5g06J.pdb.gz
15	PDB:5eanA	0.160	0.380	1.254E-25	1051	0.061	0.154	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
16	PDB:4pj3A	0.168	0.311	1.317E-25	1335	0.059	0.117	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
17	PDB:2ix1A	0.152	0.552	1.741E-24	643	0.042	0.174	2ix1A.pdb.gz	Unravelling the Dynamics of RNA Degradation by Ribonuclease II and its RNA-Bound Complex
18	PDB:6f3hB	0.126	0.390	7.459E-16	790	0.031	0.105	6f3hB.pdb.gz	Structural analysis of mtEXO mitochondrial RNA degradosome reveals tight coupling of nuclease and helicase components.
19	PDB:3jb9X	0.148	0.296	9.393E-15	1195	0.040	0.089	3jb9X.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
20	PDB:3k70D	0.099	0.384	2.221E-9	547	0.034	0.163	3k70D.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QAM5	0.0	3676	2947	0.706	0.635	HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus OX=10090 GN=Helz2 PE=1 SV=1
2	Q9BYK8	0.0	5405	2649	1.000	1.000	HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens OX=9606 GN=HELZ2 PE=1 SV=6
3	Q6DFV5	7.38e-135	473	1964	0.122	0.164	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
4	P42694	5.37e-134	470	1942	0.119	0.162	HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2
5	Q582F1	7.93e-50	195	842	0.060	0.188	Q582F1_TRYB2 Regulator of nonsense transcripts 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.50 PE=3 SV=1
6	O76512	2.02e-49	196	1069	0.065	0.161	RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans OX=6239 GN=smg-2 PE=1 SV=1
7	Q9FJR0	2.20e-49	196	1254	0.066	0.140	RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana OX=3702 GN=UPF1 PE=1 SV=2
8	A0A024R7L5	2.44e-46	186	1118	0.059	0.140	A0A024R7L5_HUMAN UPF1 OS=Homo sapiens OX=9606 GN=UPF1 PE=2 SV=1
9	Q92900	2.91e-46	186	1129	0.059	0.139	RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2
10	F1RCY6	3.59e-46	185	1100	0.059	0.142	RENT1_DANRE Regulator of nonsense transcripts 1 OS=Danio rerio OX=7955 GN=upf1 PE=2 SV=1
11	Q9VYS3	4.49e-46	185	1180	0.058	0.131	RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster OX=7227 GN=Upf1 PE=1 SV=2
12	Q9EPU0	4.53e-46	185	1124	0.059	0.140	RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus OX=10090 GN=Upf1 PE=1 SV=2
13	Q09820	2.86e-45	181	925	0.057	0.164	RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf1 PE=3 SV=2
14	P30771	5.24e-44	178	971	0.057	0.154	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1
15	Q8GYD9	9.89e-37	154	1002	0.056	0.148	SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana OX=3702 GN=SDE3 PE=1 SV=1
16	O94247	4.56e-34	144	660	0.054	0.218	HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hcs1 PE=3 SV=1
17	O14040	8.93e-34	145	927	0.059	0.167	DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis32 PE=1 SV=1
18	P32644	9.36e-34	145	1121	0.052	0.123	ECM32_YEAST Putative ATP-dependent RNA helicase ECM32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ECM32 PE=1 SV=1
19	Q9BXT6	4.45e-33	143	1211	0.054	0.119	M10L1_HUMAN RNA helicase Mov10l1 OS=Homo sapiens OX=9606 GN=MOV10L1 PE=1 SV=1
20	Q9EQN5	5.95e-31	136	988	0.059	0.159	SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus OX=10116 GN=Ighmbp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.4e+02	14.3	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	2.5e-69	245.6	AAA domain
3	PF13087 AAA_12	6.8e-67	236.5	AAA domain
4	PF13245 AAA_19	2.8e-11	55.3	AAA domain
5	PF13401 AAA_22	0.0021	29.8	AAA domain
6	PF13479 AAA_24	1.1e+02	13.9	AAA domain
7	PF13604 AAA_30	6.1e-15	67.0	AAA domain
8	PF00308 Bac_DnaA	3.5e+02	12.4	Bacterial dnaA protein
9	PF09848 DUF2075	7.4	17.3	Schlafen group 3, DNA/RNA helicase domain
10	PF17849 OB_Dis3	3.3e+02	12.7	Dis3-like cold-shock domain 2 (CSD2)
11	PF02562 PhoH	0.029	25.4	PhoH-like protein
12	PF04851 ResIII	1.1	20.7	Type III restriction enzyme, res subunit
13	PF00773 RNB	6.6e-48	175.3	RNB domain
14	PF00580 UvrD-helicase	4.4	18.3	UvrD/REP helicase N-terminal domain
15	PF13361 UvrD_C	10	17.1	UvrD-like helicase C-terminal domain
16	PF13538 UvrD_C_2	0.02	26.1	UvrD-like helicase C-terminal domain
17	PF01443 Viral_helicase1	3.1	19.0	Viral (Superfamily 1) RNA helicase
18	PF12171 zf-C2H2_jaz	9.2	17.9	Zinc-finger double-stranded RNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417401

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217233	0.938	Tribbles homolog 3
2	9606.ENSP00000434516	0.929	Thioredoxin reductase 1, cytoplasmic
3	9606.ENSP00000360762	0.915	Ankyrin repeat domain-containing protein 1
4	9606.ENSP00000293217	0.914	Peroxisomal acyl-coenzyme A oxidase 1
5	9606.ENSP00000355996	0.909	G0/G1 switch protein 2
6	9606.ENSP00000276914	0.906	Perilipin-2
7	9606.ENSP00000256104	0.905	Fatty acid-binding protein, adipocyte
8	9606.ENSP00000265723	0.905	Phosphatidylcholine translocator ABCB4
9	9606.ENSP00000399421	0.905	Platelet glycoprotein 4
10	9606.ENSP00000422607	0.905	Long-chain-fatty-acid--CoA ligase 1
11	9606.ENSP00000427514	0.905	CCAAT/enhancer-binding protein alpha
12	9606.ENSP00000437188	0.904	T-lymphoma invasion and metastasis-inducing protein 2
13	9606.ENSP00000300056	0.903	Peroxisomal membrane protein 11A
14	9606.ENSP00000312652	0.903	Leptin
15	9606.ENSP00000359871	0.903	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
16	9606.ENSP00000363868	0.903	ATP-binding cassette sub-family A member 1
17	9606.ENSP00000378416	0.903	5-aminolevulinate synthase, nonspecific, mitochondrial
18	9606.ENSP00000265641	0.902	Carnitine O-palmitoyltransferase 1, liver isoform
19	9606.ENSP00000295834	0.902	Fatty acid-binding protein, liver
20	9606.ENSP00000309757	0.902	Lipoprotein lipase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0030374	0.998	nuclear receptor coactivator activity
GO:0003824	0.855	catalytic activity
GO:0140640	0.579	catalytic activity, acting on a nucleic acid
GO:0140098	0.470	catalytic activity, acting on RNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0010557	0.976	positive regulation of macromolecule biosynthetic process
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0031328	0.975	positive regulation of cellular biosynthetic process
GO:0051254	0.966	positive regulation of RNA metabolic process
GO:0045893	0.961	positive regulation of DNA-templated transcription
GO:0045944	0.924	positive regulation of transcription by RNA polymerase II
GO:0009987	0.703	cellular process
GO:0071704	0.681	organic substance metabolic process
GO:0044238	0.655	primary metabolic process
GO:0044237	0.618	cellular metabolic process
GO:1901360	0.475	organic cyclic compound metabolic process
GO:0043170	0.466	macromolecule metabolic process
GO:0034641	0.465	cellular nitrogen compound metabolic process
GO:0046483	0.431	heterocycle metabolic process
GO:0006725	0.429	cellular aromatic compound metabolic process
GO:0090304	0.416	nucleic acid metabolic process
GO:0016070	0.301	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.992	membrane
GO:0005737	0.929	cytoplasm
GO:0005829	0.631	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]