StarFunc result for job id Q9BYM8

User Input

>input (510 residues)
MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVS
VEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVR
QNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQE
PGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARL
AGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLREC
LHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISI
AENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLAL
RAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPR
WGPGGPGDTSGGCRCRVNGIPCHPSCQNCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYM8	1.000	1.000	6.562E-101	510	1.000	1.000	Q9BYM8.pdb.gz	HOIL1_HUMAN RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=RBCK1 PE=1 SV=2
2	AFDB:Q6GMF9	0.517	0.513	1.580E-66	515	0.529	0.524	Q6GMF9.pdb.gz	Q6GMF9_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=zgc:91964 PE=2 SV=1
3	AFDB:A9JTG5	0.428	0.314	1.221E-62	714	0.502	0.359	A9JTG5.pdb.gz	HOIL1_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=rbck1 PE=2 SV=1
4	AFDB:X1WDE8	0.212	0.264	7.424E-19	394	0.176	0.228	X1WDE8.pdb.gz	X1WDE8_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=sharpin PE=4 SV=1
5	AFDB:Q9H0F6	0.248	0.311	2.852E-18	387	0.188	0.248	Q9H0F6.pdb.gz	SHRPN_HUMAN Sharpin OS=Homo sapiens OX=9606 GN=SHARPIN PE=1 SV=1
6	AFDB:Q9EQL9	0.222	0.286	4.828E-18	381	0.167	0.223	Q9EQL9.pdb.gz	SHRPN_RAT Sharpin OS=Rattus norvegicus OX=10116 GN=Sharpin PE=1 SV=1
7	AFDB:Q91WA6	0.241	0.307	2.211E-17	380	0.171	0.229	Q91WA6.pdb.gz	SHRPN_MOUSE Sharpin OS=Mus musculus OX=10090 GN=Sharpin PE=1 SV=1
8	AFDB:Q9UBS8	0.244	0.260	1.088E-11	474	0.153	0.165	Q9UBS8.pdb.gz	RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens OX=9606 GN=RNF14 PE=1 SV=1
9	AFDB:P50876	0.310	0.509	1.154E-11	292	0.092	0.161	P50876.pdb.gz	R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=2
10	AFDB:F1RB95	0.236	0.261	1.953E-11	459	0.133	0.148	F1RB95.pdb.gz	RNF14_DANRE E3 ubiquitin-protein ligase RNF14 OS=Danio rerio OX=7955 GN=rnf14 PE=2 SV=1
11	PDB:4zynB	0.181	0.228	1.633E-9	385	0.129	0.171	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.
12	PDB:7od1A	0.177	0.203	3.423E-8	430	0.088	0.105	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
13	PDB:5tteB	0.219	0.247	1.478E-7	442	0.098	0.113	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
14	PDB:4kblA	0.213	0.265	7.608E-7	395	0.092	0.119	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
15	PDB:7b5lH	0.297	0.350	1.081E-6	423	0.096	0.116	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
16	PDB:3ai5A	0.141	0.237	2.265E-5	299	0.035	0.060	3ai5A.pdb.gz
17	PDB:7rbsB	0.135	0.389	3.218E-5	157	0.037	0.121	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
18	PDB:7oniH	0.195	0.250	3.412E-5	380	0.078	0.105	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
19	PDB:3dbhI	0.145	0.754	4.067E-5	86	0.031	0.186	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
20	PDB:3plvA	0.139	0.764	9.225E-5	80	0.035	0.225	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q62921	0.0	908	508	0.908	0.911	HOIL1_RAT RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Rbck1 PE=1 SV=3
2	Q6GMF9	0.0	536	515	0.531	0.526	Q6GMF9_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=zgc:91964 PE=2 SV=1
3	Q9BYM8	0.0	1055	510	1.000	1.000	HOIL1_HUMAN RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=RBCK1 PE=1 SV=2
4	Q9WUB0	0.0	912	508	0.912	0.915	HOIL1_MOUSE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Mus musculus OX=10090 GN=Rbck1 PE=1 SV=2
5	A9JTG5	5.14e-164	483	714	0.496	0.354	HOIL1_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=rbck1 PE=2 SV=1
6	X1WDE8	5.98e-34	134	394	0.176	0.228	X1WDE8_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=sharpin PE=4 SV=1
7	Q9H0F6	1.56e-33	133	387	0.184	0.243	SHRPN_HUMAN Sharpin OS=Homo sapiens OX=9606 GN=SHARPIN PE=1 SV=1
8	Q91WA6	1.07e-30	125	380	0.175	0.234	SHRPN_MOUSE Sharpin OS=Mus musculus OX=10090 GN=Sharpin PE=1 SV=1
9	Q9EQL9	5.03e-29	120	381	0.171	0.228	SHRPN_RAT Sharpin OS=Rattus norvegicus OX=10116 GN=Sharpin PE=1 SV=1
10	F1RB95	2.03e-10	65.1	459	0.118	0.131	RNF14_DANRE E3 ubiquitin-protein ligase RNF14 OS=Danio rerio OX=7955 GN=rnf14 PE=2 SV=1
11	Q8TC41	2.59e-10	65.1	542	0.104	0.098	RN217_HUMAN E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens OX=9606 GN=RNF217 PE=1 SV=4
12	Q6ZMZ0	7.44e-08	57.4	732	0.122	0.085	RN19B_HUMAN E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens OX=9606 GN=RNF19B PE=1 SV=2
13	P36113	1.94e-07	55.8	551	0.098	0.091	HEL1_YEAST E3 ubiquitin-protein ligase HEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEL1 PE=1 SV=1
14	Q20871	3.17e-07	55.1	437	0.094	0.110	Q20871_CAEEL RBR-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=CELE_F56D2.5 PE=1 SV=2
15	Q9UBS8	3.28e-07	55.1	474	0.116	0.124	RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens OX=9606 GN=RNF14 PE=1 SV=1
16	Q9NWF9	5.43e-07	54.7	866	0.116	0.068	RN216_HUMAN E3 ubiquitin-protein ligase RNF216 OS=Homo sapiens OX=9606 GN=RNF216 PE=1 SV=3
17	A2A7Q9	6.94e-07	54.3	732	0.118	0.082	RN19B_MOUSE E3 ubiquitin-protein ligase RNF19B OS=Mus musculus OX=10090 GN=Rnf19b PE=1 SV=2
18	D3ZU60	7.20e-07	54.3	910	0.100	0.056	D3ZU60_RAT Ring finger protein 216 OS=Rattus norvegicus OX=10116 GN=Rnf216 PE=4 SV=2
19	Q9LZH2	8.18e-07	53.5	346	0.118	0.173	Q9LZH2_ARATH RING/U-box protein with C6HC-type zinc finger domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=RFA1 PE=3 SV=1
20	Q7Z419	8.19e-06	50.1	303	0.094	0.158	R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens OX=9606 GN=RNF144B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01485 IBR	0.0015	30.0	IBR domain, a half RING-finger domain
2	PF00240 ubiquitin	28	15.9	Ubiquitin family
3	PF13923 zf-C3HC4_2	0.007	27.5	Zinc finger, C3HC4 type (RING finger)
4	PF15227 zf-C3HC4_4	13	17.3	zinc finger of C3HC4-type, RING
5	PF00641 zf-RanBP	0.098	23.3	Zn-finger in Ran binding protein and others
6	PF17123 zf-RING_11	8.7	17.5	RING-like zinc finger
7	PF13639 zf-RING_2	0.0013	30.4	Ring finger domain
8	PF14634 zf-RING_5	0.0044	28.3	zinc-RING finger domain
9	PF13445 zf-RING_UBOX	3.7e-07	41.4	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348632

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315112	0.999	E3 ubiquitin-protein ligase RNF31
2	9606.ENSP00000381698	0.997	Sharpin
3	9606.ENSP00000483825	0.986	NF-kappa-B essential modulator
4	9606.ENSP00000284274	0.985	Ubiquitin thioesterase otulin
5	9606.ENSP00000162749	0.972	Tumor necrosis factor receptor superfamily member 1A
6	9606.ENSP00000398698	0.971	Tumor necrosis factor
7	9606.ENSP00000481570	0.966	Tumor necrosis factor alpha-induced protein 3
8	9606.ENSP00000392025	0.959	Ubiquitin carboxyl-terminal hydrolase CYLD
9	9606.ENSP00000259808	0.957	Receptor-interacting serine/threonine-protein kinase 1
10	9606.ENSP00000349722	0.948	Ubiquitin conjugating enzyme E2 D3
11	9606.ENSP00000260187	0.932	Ubiquitin carboxyl-terminal hydrolase 2
12	9606.ENSP00000462729	0.929	OTU domain-containing protein 7B
13	9606.ENSP00000265560	0.924	Ubiquitin carboxyl-terminal hydrolase 4
14	9606.ENSP00000416799	0.921	Spermatogenesis-associated protein 2
15	9606.ENSP00000356981	0.920	Ubiquitin carboxyl-terminal hydrolase 21
16	9606.ENSP00000263464	0.913	Baculoviral IAP repeat-containing protein 3
17	9606.ENSP00000477613	0.912	Baculoviral IAP repeat-containing protein 2
18	9606.ENSP00000426909	0.900	Receptor of activated protein C kinase 1
19	9606.ENSP00000305355	0.897	Protein kinase C beta type
20	9606.ENSP00000441543	0.892	Polyubiquitin-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004842	0.995	ubiquitin-protein transferase activity
GO:0042802	0.830	identical protein binding
GO:0032182	0.819	ubiquitin-like protein binding
GO:0043130	0.805	ubiquitin binding
GO:0140311	0.787	protein sequestering activity
GO:0003713	0.753	transcription coactivator activity
GO:0019900	0.574	kinase binding
GO:0019901	0.564	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.990	positive regulation of biological process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.983	primary metabolic process
GO:0009966	0.982	regulation of signal transduction
GO:0048522	0.979	positive regulation of cellular process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0006807	0.967	nitrogen compound metabolic process
GO:0019219	0.967	regulation of nucleobase-containing compound metabolic process
GO:0043123	0.965	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0010468	0.964	regulation of gene expression
GO:0010556	0.956	regulation of macromolecule biosynthetic process
GO:0031326	0.955	regulation of cellular biosynthetic process
GO:0051252	0.955	regulation of RNA metabolic process
GO:0050896	0.952	response to stimulus
GO:0009987	0.951	cellular process
GO:0043170	0.948	macromolecule metabolic process
GO:0006355	0.948	regulation of DNA-templated transcription
GO:1901564	0.925	organonitrogen compound metabolic process
GO:0019538	0.919	protein metabolic process
GO:0016567	0.902	protein ubiquitination
GO:0051090	0.875	regulation of DNA-binding transcription factor activity
GO:0051716	0.856	cellular response to stimulus
GO:0010941	0.838	regulation of cell death
GO:0048519	0.826	negative regulation of biological process
GO:0043067	0.817	regulation of programmed cell death
GO:0009893	0.793	positive regulation of metabolic process
GO:0010604	0.780	positive regulation of macromolecule metabolic process
GO:0048523	0.776	negative regulation of cellular process
GO:0051173	0.759	positive regulation of nitrogen compound metabolic process
GO:1901222	0.755	regulation of NIK/NF-kappaB signaling
GO:0044237	0.721	cellular metabolic process
GO:0050778	0.705	positive regulation of immune response
GO:0044093	0.685	positive regulation of molecular function
GO:0007165	0.682	signal transduction
GO:0031325	0.671	positive regulation of cellular metabolic process
GO:0006950	0.637	response to stress
GO:0006508	0.633	proteolysis
GO:0051091	0.603	positive regulation of DNA-binding transcription factor activity
GO:0009605	0.589	response to external stimulus
GO:0002376	0.584	immune system process
GO:0051092	0.578	positive regulation of NF-kappaB transcription factor activity
GO:0007166	0.570	cell surface receptor signaling pathway
GO:0002764	0.565	immune response-regulating signaling pathway
GO:0002757	0.556	immune response-activating signaling pathway
GO:0009607	0.475	response to biotic stimulus
GO:0044419	0.462	biological process involved in interspecies interaction between organisms
GO:0030163	0.456	protein catabolic process
GO:0051707	0.447	response to other organism
GO:0042981	0.417	regulation of apoptotic process
GO:0006952	0.397	defense response
GO:0051603	0.367	proteolysis involved in protein catabolic process
GO:0002768	0.338	immune response-regulating cell surface receptor signaling pathway
GO:0044260	0.336	cellular macromolecule metabolic process
GO:0051179	0.335	localization
GO:0002429	0.331	immune response-activating cell surface receptor signaling pathway
GO:2001233	0.323	regulation of apoptotic signaling pathway
GO:2001236	0.306	regulation of extrinsic apoptotic signaling pathway
GO:0044092	0.300	negative regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0000151	0.999	ubiquitin ligase complex
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0005634	0.950	nucleus
GO:0031981	0.928	nuclear lumen
GO:0005654	0.913	nucleoplasm
GO:0071797	0.691	LUBAC complex
GO:0016020	0.399	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.997	Transferases.

[back to server]