StarFunc result for job id Q9BYP7

User Input

>input (1800 residues)
MATDSGDPASTEDSEKPDGISFENRVPQVAATLTVEARLKEKNSTFSASGETVERKRFFR
KSVEMTEDDKVAESSPKDERIKAAMNIPRVDKLPSNVLRGGQEVKYEQCSKSTSEISKDC
FKEKNEKEMEEEAEMKAVATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQD
RKLTKAEQQRFKEEAEMLKGLQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLK
RFKVMKPKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATL
MRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRK
VTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIRDLLNHAFFAEDTGLRVELAEEDD
CSNSSLALRLWVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV
AKSIRDRVTPIKKTREKKPAGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEE
TEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMV
SNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPT
VVSQPQVSPLTVQKVPQIKPVSQPVGAEQQAALLKPDLVRSLNQDVATTKENVSSPDNPS
GNGKQDRIKQRRASCPRPEKGTKFQLTVLQVSTSGDNMVECQLETHNNKMVTFKFDVDGD
APEDIADYMVEDNFVLESEKEKFVEELRAIVGQAQEILHVHFATERATGVDSITVDSNSS
QTGSSEQVQINSTSTQTSNESAPQSSPVGRWRFCINQTIRNRETQSPPSLQHSMSAVPGR
HPLPSPKNTSNKEISRDTLLTIENNPCHRALFTSKSEHKDVVDGKISECASVETKQPAIL
YQVEDNRQIMAPVTNSSSYSTTSVRAVPAECEGLTKQASIFIPVYPCHQTASQADALMSH
PGESTQTSGNSLTTLAFDQKPQTLSVQQPAMDAEFISQEGETTVNTEASSPKTVIPTQTP
GLEPTTLQPTTVLESDGERPPKLEFADNRIKTLDEKLRNLLYQEHSISSIYPESQKDTQS
IDSPFSSSAEDTLSCPVTEVIAISHCGIKDSPVQSPNFQQTGSKLLSNVAASQPANISVF
KRDLNVITSVPSELCLHEMSSDASLPGDPEAYPAAVSSGGAIHLQTGGGYFGLSFTCPSL
KNPISKKSWTRKLKSWAYRLRQSTSFFKRSKVRQVETEEMRSAIAPDPIPLTRESTADTR
ALNRCKAMSGSFQRGRFQVITIPQQQSAKMTSFGIEHISVFSETNHSSEEAFIKTAKSQL
VEIEPATQNPKTSFSYEKLQALQETCKENKGVPKQGDNFLSFSAACETDVSSVTPEKEFE
ETSATGSSMQSGSELLLKEREILTAGKQPSSDSEFSASLAGSGKSVAKTGPESNQCLPHH
EEQAYAQTQSSLFYSPSSPMSSDDESEIEDEDLKVELQRLREKHIQEVVNLQTQQNKELQ
ELYERLRSIKDSKTQSTEIPLPPASPRRPRSFKSKLRSRPQSLTHVDNGIVATGKSCLIN
ELENPLCVESNAASCQQSPASKKGMFTDDLHKLVDDWTKEAVGNSLIKPSLNQLKQSQHK
LETENWNKVSENTPSTMGYTSTWISSLSQIRGAVPTSLPQGLSLPSFPGPLSSYGMPHVC
QYNAVAGAGYPVQWVGISGTTQQSVVIPAQSGGPFQPGMNMQAFPTSSVQNPATIPPGPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80XP9	0.255	0.260	0.000	1757	0.793	0.812	Q80XP9.pdb.gz	WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3
2	AFDB:Q9BYP7	1.000	1.000	0.000	1800	1.000	1.000	Q9BYP7.pdb.gz	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
3	AFDB:E7F2F9	0.213	0.233	1.217E-78	1634	0.326	0.359	E7F2F9.pdb.gz	E7F2F9_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=2
4	AFDB:Q9JIH7	0.210	0.181	1.355E-78	2126	0.381	0.322	Q9JIH7.pdb.gz	WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2
5	AFDB:Q3UH66	0.217	0.184	1.514E-75	2149	0.371	0.311	Q3UH66.pdb.gz	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
6	AFDB:Q9H4A3	0.212	0.163	3.037E-75	2382	0.390	0.295	Q9H4A3.pdb.gz	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
7	AFDB:P83741	0.204	0.161	2.326E-74	2377	0.382	0.289	P83741.pdb.gz	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
8	AFDB:Q9Y3S1	0.211	0.168	2.095E-72	2297	0.365	0.286	Q9Y3S1.pdb.gz	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
9	AFDB:F1Q6T6	0.214	0.167	2.340E-69	2357	0.354	0.270	F1Q6T6.pdb.gz
10	AFDB:X5M5N0	0.193	0.188	1.913E-58	1850	0.260	0.253	X5M5N0.pdb.gz	WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1
11	PDB:5ufuA	0.132	0.596	1.342E-17	369	0.041	0.198	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
12	PDB:6s73A	0.129	0.789	2.294E-17	269	0.041	0.275	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
13	PDB:4rerA	0.132	0.486	7.865E-17	459	0.038	0.148	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
14	PDB:4krcA	0.128	0.701	1.955E-16	297	0.047	0.283	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
15	PDB:5u6yA	0.130	0.486	1.955E-16	459	0.037	0.146	5u6yA.pdb.gz
16	PDB:4eomC	0.129	0.750	2.697E-16	276	0.036	0.236	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
17	PDB:7myjC	0.135	0.484	3.924E-16	465	0.042	0.163	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
18	PDB:4d28C	0.127	0.747	4.368E-16	279	0.037	0.240	4d28C.pdb.gz
19	PDB:4c0tA	0.132	0.738	4.608E-16	291	0.038	0.237	4c0tA.pdb.gz
20	PDB:6b1uA	0.135	0.510	7.463E-16	442	0.040	0.163	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F2F9	0.0	726	1634	0.221	0.244	E7F2F9_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=2
2	E9PCD1	0.0	676	2217	0.186	0.151	E9PCD1_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
3	F5GWT4	0.0	669	2134	0.174	0.147	F5GWT4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=1
4	H0Y7T5	0.0	677	2220	0.186	0.150	H0Y7T5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=1
5	P83741	0.0	670	2377	0.171	0.129	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
6	Q3UH66	0.0	679	2149	0.177	0.148	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
7	Q7TPK6	0.0	582	1222	0.148	0.218	WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus OX=10116 GN=Wnk4 PE=1 SV=3
8	Q80UE6	0.0	581	1222	0.148	0.218	WNK4_MOUSE Serine/threonine-protein kinase WNK4 OS=Mus musculus OX=10090 GN=Wnk4 PE=1 SV=1
9	Q80XP9	0.0	2846	1757	0.793	0.813	WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3
10	Q9BYP7	0.0	3724	1800	1.000	1.000	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
11	Q9H4A3	0.0	671	2382	0.174	0.132	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
12	Q9JIH7	0.0	759	2126	0.241	0.204	WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2
13	Q9Y3S1	0.0	676	2297	0.186	0.145	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
14	X1WG08	0.0	733	1606	0.218	0.244	X1WG08_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=1
15	Q96J92	3.18e-180	580	1243	0.148	0.215	WNK4_HUMAN Serine/threonine-protein kinase WNK4 OS=Homo sapiens OX=9606 GN=WNK4 PE=1 SV=1
16	M9PGC5	6.84e-146	504	2462	0.132	0.096	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
17	X5M5N0	2.70e-142	488	1850	0.130	0.126	WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1
18	Q9STK6	6.75e-93	313	516	0.099	0.345	WNK3_ARATH Probable serine/threonine-protein kinase WNK3 OS=Arabidopsis thaliana OX=3702 GN=WNK3 PE=2 SV=1
19	Q8S8Y8	5.55e-91	310	567	0.080	0.254	WNK6_ARATH Probable serine/threonine-protein kinase WNK6 OS=Arabidopsis thaliana OX=3702 GN=WNK6 PE=2 SV=1
20	Q8LST2	1.82e-90	308	557	0.079	0.257	WNK7_ARATH Probable serine/threonine-protein kinase WNK7 OS=Arabidopsis thaliana OX=3702 GN=WNK7 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12202 OSR1_C	1.6e-30	116.3	Oxidative-stress-responsive kinase 1 C-terminal domain
2	PF00069 Pkinase	5.9e-53	191.5	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	4.4e-39	145.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346667

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353292	0.942	Amiloride-sensitive sodium channel subunit alpha
2	9606.ENSP00000300061	0.941	Amiloride-sensitive sodium channel subunit gamma
3	9606.ENSP00000345751	0.941	Amiloride-sensitive sodium channel subunit beta
4	9606.ENSP00000368411	0.912	Amiloride-sensitive sodium channel subunit delta
5	9606.ENSP00000388107	0.902	Ubiquitin-60S ribosomal protein L40
6	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000304697	0.900	Polyubiquitin-B
8	9606.ENSP00000441543	0.900	Polyubiquitin-C
9	9606.ENSP00000262461	0.889	Solute carrier family 12 member 2
10	9606.ENSP00000379822	0.881	Solute carrier family 12 member 1
11	9606.ENSP00000312397	0.878	Kelch-like protein 3
12	9606.ENSP00000387694	0.820	Solute carrier family 12 member 5
13	9606.ENSP00000395983	0.818	Solute carrier family 12 member 4
14	9606.ENSP00000264930	0.805	Solute carrier family 12 member 7
15	9606.ENSP00000402152	0.804	Solute carrier family 12 member 3
16	9606.ENSP00000424198	0.800	Kelch-like protein 2
17	9606.ENSP00000346112	0.792	Solute carrier family 12 member 6
18	9606.ENSP00000348278	0.784	STE20/SPS1-related proline-alanine-rich protein kinase
19	9606.ENSP00000364324	0.774	Constitutive coactivator of PPAR-gamma-like protein 2
20	9606.ENSP00000311713	0.762	Serine/threonine-protein kinase OSR1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0099106	1.000	ion channel regulator activity
GO:0016248	1.000	channel inhibitor activity
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0008200	0.994	ion channel inhibitor activity
GO:0019869	0.560	chloride channel inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.996	biological regulation
GO:0008152	0.988	metabolic process
GO:0006468	0.982	protein phosphorylation
GO:0042592	0.947	homeostatic process
GO:0050789	0.947	regulation of biological process
GO:0050794	0.914	regulation of cellular process
GO:0051179	0.876	localization
GO:0065008	0.868	regulation of biological quality
GO:0050896	0.842	response to stimulus
GO:0051716	0.807	cellular response to stimulus
GO:0032879	0.802	regulation of localization
GO:0048519	0.769	negative regulation of biological process
GO:0042221	0.753	response to chemical
GO:0043269	0.713	regulation of monoatomic ion transport
GO:0019725	0.690	cellular homeostasis
GO:0048518	0.680	positive regulation of biological process
GO:0070887	0.572	cellular response to chemical stimulus
GO:0048522	0.537	positive regulation of cellular process
GO:0032501	0.489	multicellular organismal process
GO:0048878	0.482	chemical homeostasis
GO:0006950	0.418	response to stress
GO:0051234	0.395	establishment of localization
GO:0006810	0.394	transport
GO:0006811	0.384	monoatomic ion transport
GO:0071840	0.375	cellular component organization or biogenesis
GO:0009628	0.360	response to abiotic stimulus
GO:0016043	0.342	cellular component organization
GO:0050801	0.327	monoatomic ion homeostasis
GO:0034765	0.322	regulation of monoatomic ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.626	organelle
GO:0043229	0.581	intracellular organelle
GO:0043227	0.488	membrane-bounded organelle
GO:0071944	0.481	cell periphery
GO:0005886	0.450	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]