StarFunc result for job id Q9BYT1

User Input

>input (436 residues)
MQPPPDEARRDMAGDTQWSRPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKK
EAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLSSAHLAF
MTFSRILMGLLQGVYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEW
YGWQSIFYFSGGLTLLWVWYVYRYLLSEKDLILALGVLAQSRPVSRHNRVPWRRLFRKPA
VWAAVVSQLSAACSFFILLSWLPTFFEETFPDAKGWIFNVVPWLVAIPASLFSGFLSDHL
INQGYRAITVRKLMQGMGLGLSSVFALCLGHTSSFCESVVFASASIGLQTFNHSGISVNI
QDLAPSCAGFLFGVANTAGALAGVVGVCLGGYLMETTGSWTCLFNLVAIISNLGLCTFLV
FGQAQRVDLSSTHEDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYT1	1.000	1.000	8.601E-57	436	1.000	1.000	Q9BYT1.pdb.gz	S17A9_HUMAN Voltage-gated purine nucleotide uniporter SLC17A9 OS=Homo sapiens OX=9606 GN=SLC17A9 PE=1 SV=2
2	AFDB:A6QPJ4	0.972	0.936	5.995E-51	453	0.888	0.854	A6QPJ4.pdb.gz	A6QPJ4_BOVIN SLC17A9 protein OS=Bos taurus OX=9913 GN=SLC17A9 PE=2 SV=1
3	AFDB:D3ZUN1	0.963	0.940	2.306E-48	447	0.819	0.799	D3ZUN1.pdb.gz	D3ZUN1_RAT Solute carrier family 17 member 9 OS=Rattus norvegicus OX=10116 GN=Slc17a9 PE=4 SV=1
4	AFDB:Q8GX78	0.846	0.685	4.447E-23	541	0.298	0.240	Q8GX78.pdb.gz	ANTR2_ARATH Ascorbate transporter, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PHT4;4 PE=1 SV=1
5	AFDB:Q3E9A0	0.832	0.704	8.893E-23	517	0.289	0.244	Q3E9A0.pdb.gz	ANTR6_ARATH Probable anion transporter 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR6 PE=2 SV=1
6	AFDB:O82390	0.845	0.722	3.859E-22	512	0.287	0.244	O82390.pdb.gz	ANTR1_ARATH Sodium-dependent phosphate transport protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR1 PE=1 SV=1
7	AFDB:Q66GI9	0.847	0.697	5.570E-22	533	0.282	0.231	Q66GI9.pdb.gz	ANTR4_ARATH Probable anion transporter 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR4 PE=2 SV=1
8	AFDB:Q7XJR2	0.847	0.724	1.311E-21	512	0.287	0.244	Q7XJR2.pdb.gz	ANTR3_ARATH Probable anion transporter 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR3 PE=2 SV=2
9	AFDB:Q23514	0.846	0.772	2.417E-21	479	0.287	0.261	Q23514.pdb.gz	Q23514_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slc-17.1 PE=4 SV=3
10	AFDB:Q9FKV1	0.823	0.831	8.213E-21	432	0.278	0.280	Q9FKV1.pdb.gz	ANTR5_ARATH Probable anion transporter 5 OS=Arabidopsis thaliana OX=3702 GN=ANTR5 PE=2 SV=1
11	PDB:1pw4A	0.702	0.705	6.579E-9	434	0.149	0.150	1pw4A.pdb.gz
12	PDB:6kkkA	0.725	0.819	9.116E-9	381	0.142	0.163	6kkkA.pdb.gz
13	PDB:6oopA	0.718	0.790	1.316E-8	392	0.126	0.140	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
14	PDB:4u4tA	0.684	0.673	6.721E-8	444	0.138	0.135	4u4tA.pdb.gz	Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK
15	PDB:4ja4A	0.671	0.663	1.582E-7	442	0.126	0.124	4ja4A.pdb.gz
16	PDB:7yr5A	0.687	0.770	2.105E-7	385	0.122	0.138	7yr5A.pdb.gz
17	PDB:4jr9A	0.649	0.688	3.038E-7	409	0.149	0.159	4jr9A.pdb.gz	Crystal structure of a nitrate/nitrite exchanger.
18	PDB:4q65A	0.641	0.640	3.038E-7	437	0.151	0.151	4q65A.pdb.gz
19	PDB:6thaA	0.649	0.634	4.567E-7	448	0.131	0.127	6thaA.pdb.gz
20	PDB:7wsmA	0.638	0.604	9.134E-7	464	0.177	0.166	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6QPJ4	0.0	756	453	0.888	0.854	A6QPJ4_BOVIN SLC17A9 protein OS=Bos taurus OX=9913 GN=SLC17A9 PE=2 SV=1
2	D3ZUN1	0.0	734	447	0.819	0.799	D3ZUN1_RAT Solute carrier family 17 member 9 OS=Rattus norvegicus OX=10116 GN=Slc17a9 PE=4 SV=1
3	Q8VCL5	0.0	738	447	0.823	0.803	S17A9_MOUSE Voltage-gated purine nucleotide uniporter SLC17A9 OS=Mus musculus OX=10090 GN=Slc17a9 PE=1 SV=3
4	Q9BYT1	0.0	880	436	1.000	1.000	S17A9_HUMAN Voltage-gated purine nucleotide uniporter SLC17A9 OS=Homo sapiens OX=9606 GN=SLC17A9 PE=1 SV=2
5	Q8GX78	2.73e-65	220	541	0.307	0.248	ANTR2_ARATH Ascorbate transporter, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PHT4;4 PE=1 SV=1
6	O82390	4.39e-62	211	512	0.305	0.260	ANTR1_ARATH Sodium-dependent phosphate transport protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR1 PE=1 SV=1
7	Q3E9A0	8.23e-54	189	517	0.305	0.257	ANTR6_ARATH Probable anion transporter 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR6 PE=2 SV=1
8	Q7XJR2	1.77e-51	182	512	0.298	0.254	ANTR3_ARATH Probable anion transporter 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR3 PE=2 SV=2
9	Q9FKV1	1.05e-48	173	432	0.291	0.294	ANTR5_ARATH Probable anion transporter 5 OS=Arabidopsis thaliana OX=3702 GN=ANTR5 PE=2 SV=1
10	Q66GI9	1.80e-45	167	533	0.282	0.231	ANTR4_ARATH Probable anion transporter 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR4 PE=2 SV=1
11	Q2PJ91	2.57e-45	165	474	0.317	0.291	Q2PJ91_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slc-17.1 PE=4 SV=1
12	Q23514	8.87e-45	164	479	0.312	0.284	Q23514_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slc-17.1 PE=4 SV=3
13	Q9NRA2	4.03e-44	162	495	0.284	0.251	S17A5_HUMAN Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=2
14	Q62634	7.39e-43	160	560	0.268	0.209	VGLU1_RAT Vesicular glutamate transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc17a7 PE=1 SV=1
15	Q3TXX4	8.34e-43	160	560	0.268	0.209	VGLU1_MOUSE Vesicular glutamate transporter 1 OS=Mus musculus OX=10090 GN=Slc17a7 PE=1 SV=2
16	B2RE38	2.20e-42	158	495	0.282	0.248	B2RE38_HUMAN cDNA, FLJ96906, highly similar to Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 (SLC17A5), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
17	Q1L8X9	6.44e-42	158	590	0.259	0.192	VGLU3_DANRE Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2
18	Q9P2U8	1.50e-41	157	582	0.264	0.198	VGLU2_HUMAN Vesicular glutamate transporter 2 OS=Homo sapiens OX=9606 GN=SLC17A6 PE=2 SV=1
19	Q5W8I8	1.66e-41	157	584	0.261	0.195	VGL2A_DANRE Vesicular glutamate transporter 2.1 OS=Danio rerio OX=7955 GN=slc17a6b PE=2 SV=2
20	Q9P2U7	2.41e-41	156	560	0.264	0.205	VGLU1_HUMAN Vesicular glutamate transporter 1 OS=Homo sapiens OX=9606 GN=SLC17A7 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	7e-53	191.4	Major Facilitator Superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359376

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320232	0.731	Coiled-coil domain containing 168
2	9606.ENSP00000311833	0.719	Glucose-6-phosphate exchanger SLC37A2
3	9606.ENSP00000455079	0.704	Uncharacterized protein C16orf95
4	9606.ENSP00000261514	0.695	H(+)/Cl(-) exchange transporter 3
5	9606.ENSP00000324292	0.689	Fas-binding factor 1
6	9606.ENSP00000340523	0.685	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
7	9606.ENSP00000328133	0.667	Interleukin-20 receptor subunit beta
8	9606.ENSP00000442460	0.663	Protein-tyrosine kinase 6
9	9606.ENSP00000367756	0.662	Protein unc-13 homolog B
10	9606.ENSP00000219481	0.661	Peroxisomal 2,4-dienoyl-CoA reductase
11	9606.ENSP00000366135	0.657	Exosome component 10
12	9606.ENSP00000473172	0.654	RuvB-like 2
13	9606.ENSP00000481728	0.640	ATP-binding cassette sub-family G member 4
14	9606.ENSP00000267199	0.633	Vacuolar protein sorting-associated protein 33A
15	9606.ENSP00000344648	0.623	Glucose-6-phosphate exchanger SLC37A1
16	9606.ENSP00000227638	0.575	Pannexin-1
17	9606.ENSP00000200453	0.562	Protein phosphatase 1 regulatory subunit 15A
18	9606.ENSP00000255858	0.531	SEC14-like protein 4
19	9606.ENSP00000284288	0.530	Pannexin-3
20	9606.ENSP00000274432	0.525	Spermatogenesis-associated protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	1.000	salt transmembrane transporter activity
GO:0008514	1.000	organic anion transmembrane transporter activity
GO:0015318	0.999	inorganic molecular entity transmembrane transporter activity
GO:0015291	0.999	secondary active transmembrane transporter activity
GO:1901505	0.998	carbohydrate derivative transmembrane transporter activity
GO:0015605	0.998	organophosphate ester transmembrane transporter activity
GO:0005515	0.997	protein binding
GO:0015217	0.992	ADP transmembrane transporter activity
GO:0005347	0.992	ATP transmembrane transporter activity
GO:0015075	0.536	monoatomic ion transmembrane transporter activity
GO:0046943	0.415	carboxylic acid transmembrane transporter activity
GO:0008324	0.392	monoatomic cation transmembrane transporter activity
GO:0022890	0.365	inorganic cation transmembrane transporter activity
GO:0022853	0.345	active monoatomic ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071702	0.991	organic substance transport
GO:0009987	0.988	cellular process
GO:0015748	0.946	organophosphate ester transport
GO:0015711	0.918	organic anion transport
GO:0071705	0.906	nitrogen compound transport
GO:1901264	0.904	carbohydrate derivative transport
GO:0015931	0.810	nucleobase-containing compound transport
GO:0051503	0.798	adenine nucleotide transport
GO:0015867	0.739	ATP transport
GO:0065007	0.416	biological regulation
GO:0055085	0.394	transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0098588	0.999	bounding membrane of organelle
GO:0031410	0.995	cytoplasmic vesicle
GO:0099503	0.987	secretory vesicle
GO:0030141	0.978	secretory granule
GO:0012506	0.957	vesicle membrane
GO:0030659	0.952	cytoplasmic vesicle membrane
GO:0042583	0.942	chromaffin granule
GO:0030667	0.899	secretory granule membrane
GO:0071944	0.410	cell periphery
GO:0005886	0.357	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]