StarFunc result for job id Q9BYT8

User Input

>input (704 residues)
MIARCLLAVRSLRRVGGSRILLRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQIKTR
TEELIVQTKQVYDAVGMLGIEEVTYENCLQALADVEVKYIVERTMLDFPQHVSSDKEVRA
ASTEADKRLSRFDIEMSMRGDIFERIVHLQETCDLGKIKPEARRYLEKSIKMGKRNGLHL
PEQVQNEIKSMKKRMSELCIDFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDDKYK
ITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHA
DFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGFEYDGKINAWD
LYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNTYQELLGLSFEQMTDAHVWNKSVTL
YTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMAVAALVVNFSQPV
AGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVD
SLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEY
AKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPE
VGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRGLHAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02038	0.973	0.973	3.082E-100	704	0.945	0.945	Q02038.pdb.gz	NEUL_PIG Neurolysin, mitochondrial OS=Sus scrofa OX=9823 GN=NLN PE=1 SV=1
2	AFDB:P42676	0.972	0.972	3.249E-98	704	0.893	0.893	P42676.pdb.gz	NEUL_RAT Neurolysin, mitochondrial OS=Rattus norvegicus OX=10116 GN=Nln PE=1 SV=1
3	PDB:5lv0A	0.927	0.979	7.798E-93	666	0.945	0.998	5lv0A.pdb.gz	Structural and functional analysis of Neurolysin, a new component of the mitochondrial peptidolytic network
4	AFDB:P24155	0.918	0.940	1.284E-76	687	0.604	0.619	P24155.pdb.gz	THOP1_RAT Thimet oligopeptidase OS=Rattus norvegicus OX=10116 GN=Thop1 PE=1 SV=4
5	AFDB:P52888	0.919	0.939	4.295E-76	689	0.608	0.621	P52888.pdb.gz	THOP1_HUMAN Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2
6	PDB:2o36A	0.887	0.953	3.295E-75	654	0.605	0.651	2o36A.pdb.gz	Swapping the substrate specificities of the neuropeptidases neurolysin and thimet oligopeptidase.
7	AFDB:P25375	0.900	0.890	8.826E-52	712	0.345	0.341	P25375.pdb.gz	PRTD_YEAST Saccharolysin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRD1 PE=1 SV=1
8	AFDB:F4KDA5	0.855	0.853	4.192E-41	706	0.216	0.215	F4KDA5.pdb.gz	MIP_ARATH Mitochondrial intermediate peptidase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OCT1 PE=3 SV=1
9	AFDB:P27298	0.846	0.874	4.376E-41	680	0.277	0.287	P27298.pdb.gz	OPDA_ECOLI Oligopeptidase A OS=Escherichia coli (strain K12) OX=83333 GN=prlC PE=3 SV=3
10	AFDB:Q94AM1	0.838	0.750	2.997E-39	791	0.276	0.245	Q94AM1.pdb.gz	OOPDA_ARATH Organellar oligopeptidase A, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OOP PE=1 SV=1
11	AFDB:A6H611	0.805	0.798	5.976E-39	711	0.229	0.226	A6H611.pdb.gz	MIPEP_MOUSE Mitochondrial intermediate peptidase OS=Mus musculus OX=10090 GN=Mipep PE=1 SV=1
12	PDB:4ka7A	0.830	0.840	5.217E-38	695	0.256	0.259	4ka7A.pdb.gz	Organellar oligopeptidase (OOP) provides a complementary pathway for targeting peptide degradation in mitochondria and chloroplasts.
13	AFDB:Q99797	0.817	0.807	7.613E-38	713	0.224	0.222	Q99797.pdb.gz	MIPEP_HUMAN Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2
14	PDB:1y791	0.832	0.860	9.569E-33	680	0.220	0.228	1y791.pdb.gz	Crystal Structure of the E.coli Dipeptidyl Carboxypeptidase Dcp: Further Indication of a Ligand-dependant Hinge Movement Mechanism
15	PDB:5a2rA	0.546	0.631	1.212E-10	597	0.143	0.169	5a2rA.pdb.gz	A New High-Resolution Crystal Structure of the Drosophila Melanogaster Angiotensin Converting Enzyme Homologue, Ance.
16	PDB:7q3yA	0.547	0.341	1.503E-10	1201	0.131	0.077	7q3yA.pdb.gz	Cryo-EM reveals mechanisms of angiotensin I-converting enzyme allostery and dimerization.
17	PDB:7c8jA	0.534	0.532	4.053E-10	707	0.126	0.126	7c8jA.pdb.gz	Cross-species recognition of SARS-CoV-2 to bat ACE2.
18	PDB:3hq2B	0.472	0.637	5.976E-10	497	0.129	0.183	3hq2B.pdb.gz	Insight into the substrate length restriction of M32 carboxypeptidases: Characterization of two distinct subfamilies.
19	PDB:5wvuA	0.487	0.649	3.077E-9	510	0.125	0.173	5wvuA.pdb.gz	Insight into the transition between the open and closed conformations of Thermus thermophilus carboxypeptidase.
20	PDB:1ka2A	0.490	0.665	3.213E-9	497	0.122	0.173	1ka2A.pdb.gz	Crystal Structure of a Novel Carboxypeptidase from the Hyperthermophilic Archaeon Pyrococcus furiosus

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24155	0.0	919	687	0.601	0.616	THOP1_RAT Thimet oligopeptidase OS=Rattus norvegicus OX=10116 GN=Thop1 PE=1 SV=4
2	P42676	0.0	1315	704	0.895	0.895	NEUL_RAT Neurolysin, mitochondrial OS=Rattus norvegicus OX=10116 GN=Nln PE=1 SV=1
3	P52888	0.0	929	689	0.605	0.618	THOP1_HUMAN Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2
4	Q02038	0.0	1368	704	0.945	0.945	NEUL_PIG Neurolysin, mitochondrial OS=Sus scrofa OX=9823 GN=NLN PE=1 SV=1
5	Q8C1A5	0.0	920	687	0.604	0.619	THOP1_MOUSE Thimet oligopeptidase OS=Mus musculus OX=10090 GN=Thop1 PE=1 SV=1
6	Q91YP2	0.0	1326	704	0.902	0.902	NEUL_MOUSE Neurolysin, mitochondrial OS=Mus musculus OX=10090 GN=Nln PE=1 SV=1
7	Q96CV8	0.0	928	689	0.604	0.617	Q96CV8_HUMAN Thimet oligopeptidase 1 OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=1
8	Q9BYT8	0.0	1471	704	1.000	1.000	NEUL_HUMAN Neurolysin, mitochondrial OS=Homo sapiens OX=9606 GN=NLN PE=1 SV=1
9	P25375	8.39e-133	410	712	0.354	0.350	PRTD_YEAST Saccharolysin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRD1 PE=1 SV=1
10	P27298	2.54e-93	306	680	0.286	0.296	OPDA_ECOLI Oligopeptidase A OS=Escherichia coli (strain K12) OX=83333 GN=prlC PE=3 SV=3
11	Q94AM1	2.42e-72	252	791	0.261	0.233	OOPDA_ARATH Organellar oligopeptidase A, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OOP PE=1 SV=1
12	Q949P2	4.89e-72	249	701	0.274	0.275	COPDA_ARATH Probable cytosolic oligopeptidase A OS=Arabidopsis thaliana OX=3702 GN=CYOP PE=1 SV=1
13	F4KDA5	5.49e-59	213	706	0.203	0.203	MIP_ARATH Mitochondrial intermediate peptidase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OCT1 PE=3 SV=1
14	Q99797	2.73e-47	180	713	0.237	0.234	MIPEP_HUMAN Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2
15	P24171	9.44e-47	178	681	0.222	0.229	DCP_ECOLI Dipeptidyl carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=dcp PE=1 SV=4
16	A6H611	2.37e-45	175	711	0.169	0.167	MIPEP_MOUSE Mitochondrial intermediate peptidase OS=Mus musculus OX=10090 GN=Mipep PE=1 SV=1
17	Q10415	2.51e-39	157	762	0.222	0.205	PMIP_SCHPO Mitochondrial intermediate peptidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oct1 PE=3 SV=1
18	P35999	6.78e-39	156	772	0.196	0.179	PMIP_YEAST Mitochondrial intermediate peptidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCT1 PE=1 SV=2
19	Q01992	1.22e-38	155	710	0.163	0.162	MIPEP_RAT Mitochondrial intermediate peptidase OS=Rattus norvegicus OX=10116 GN=Mipep PE=1 SV=1
20	Q389Z4	2.27e-29	126	675	0.180	0.188	Q389Z4_TRYB2 Mitochondrial intermediate peptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0490 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01432 Peptidase_M3	1.7e-149	510.7	Peptidase family M3
2	PF19310 TOP_N	92	14.3	Neurolysin/Thimet oligopeptidase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370372

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256010	0.994	Neurotensin/neuromedin N
2	9606.ENSP00000479130	0.683	Acyl-CoA synthetase family member 3, mitochondrial
3	9606.ENSP00000370377	0.669	Presequence protease, mitochondrial
4	9606.ENSP00000285093	0.650	3-ketoacyl-CoA thiolase, mitochondrial
5	9606.ENSP00000358106	0.638	Prolyl endopeptidase
6	9606.ENSP00000465589	0.637	Long-chain-fatty-acid--CoA ligase ACSBG2
7	9606.ENSP00000359532	0.636	Neurotensin receptor type 1
8	9606.ENSP00000312618	0.632	Acyl-CoA dehydrogenase family member 9, mitochondrial
9	9606.ENSP00000378897	0.617	Neutral ceramidase
10	9606.ENSP00000363118	0.615	Putative inactive neutral ceramidase B
11	9606.ENSP00000380855	0.615	Programmed cell death 1 ligand 2
12	9606.ENSP00000312002	0.614	Hepatitis A virus cellular receptor 2
13	9606.ENSP00000386213	0.614	Myosin-IIIb
14	9606.ENSP00000278590	0.611	Probable ribonuclease ZC3H12C
15	9606.ENSP00000361120	0.583	Ral guanine nucleotide dissociation stimulator
16	9606.ENSP00000290866	0.582	Angiotensin-converting enzyme
17	9606.ENSP00000258301	0.579	Syntaxin-6
18	9606.ENSP00000377055	0.574	Lysosomal Pro-X carboxypeptidase
19	9606.ENSP00000265023	0.563	Kininogen-1
20	9606.ENSP00000404833	0.562	Tapasin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	1.000	metalloendopeptidase activity
GO:0005488	0.940	binding
GO:0005515	0.714	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0065007	0.982	biological regulation
GO:0008152	0.975	metabolic process
GO:0050789	0.968	regulation of biological process
GO:0071704	0.961	organic substance metabolic process
GO:0050794	0.954	regulation of cellular process
GO:0006807	0.926	nitrogen compound metabolic process
GO:1901564	0.910	organonitrogen compound metabolic process
GO:0044238	0.794	primary metabolic process
GO:0043170	0.701	macromolecule metabolic process
GO:0019538	0.691	protein metabolic process
GO:0050896	0.688	response to stimulus
GO:0044237	0.560	cellular metabolic process
GO:0051716	0.413	cellular response to stimulus
GO:0007154	0.408	cell communication
GO:0019222	0.380	regulation of metabolic process
GO:0023052	0.370	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0005829	0.988	cytosol
GO:0005576	0.981	extracellular region
GO:0016020	0.937	membrane
GO:0071944	0.729	cell periphery
GO:0070013	0.725	intracellular organelle lumen
GO:0005886	0.712	plasma membrane
GO:0031982	0.404	vesicle
GO:0005615	0.387	extracellular space
GO:0005634	0.341	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.

[back to server]