StarFunc result for job id Q9BYT9

User Input

>input (981 residues)
MVHHSGSIQSFKQQKGMNISKSEITKETSLKPSRRSLPCLAQSYAYSKSLSQSTSLFQST
ESESQAPTSITLISTDKAEQVNTEENKNDSVLRCSFADLSDFCLALGKDKDYTDESEHAT
YDRSRLINDFVIKDKSEFKTKLSKNDMNYIASSGPLFKDGKKRIDYILVYRKTNIQYDKR
NTFEKNLRAEGLMLEKEPAIASPDIMFIKIHIPWDTLCKYAERLNIRMPFRKKCYYTDGR
SKSMGRMQTYFRRIKNWMAQNPMVLDKSAFPDLEESDCYTGPFSRARIHHFIINNKDTFF
SNATRSRIVYHMLERTKYENGISKVGIRKLINNGSYIAAFPPHEGAYKSSQPIKTHGPQN
NRHLLYERWARWGMWYKHQPLDLIRLYFGEKIGLYFAWLGWYTGMLIPAAIVGLCVFFYG
LFTMNNSQVSQEICKATEVFMCPLCDKNCSLQRLNDSCIYAKVTYLFDNGGTVFFAIFMA
IWATVFLEFWKRRRSILTYTWDLIEWEEEEETLRPQFEAKYYKMEIVNPITGKPEPHQPS
SDKVTRLLVSVSGIFFMISLVITAVFGVVVYRLVVMEQFASFKWNFIKQYWQFATSAAAV
CINFIIIMLLNLAYEKIAYLLTNLEYPRTESEWENSFALKMFLFQFVNLNSSIFYIAFFL
GRFVGHPGKYNKLFDRWRLEECHPSGCLIDLCLQMGVIMFLKQIWNNFMELGYPLIQNWW
SRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIFVAAFPLAPLLAL
LNNIIEIRLDAYKFVTQWRRPLPARATDIGIWLGILEGIGILAVITNAFVIAITSDYIPR
FVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSELGMGKSGYCRYRDYRGPPWSSKPY
EFTLQYWHILAARLAFIIVFEHLVFGIKSFIAYLIPDVPKGLHDRIRREKYLVQEMMYEA
ELEHLQQQRRKSGQPVHHEWP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AHL1	0.888	0.888	0.000	981	0.936	0.936	A2AHL1.pdb.gz	ANO3_MOUSE Anoctamin-3 OS=Mus musculus OX=10090 GN=Ano3 PE=1 SV=1
2	AFDB:Q32M45	0.834	0.857	2.021E-101	955	0.603	0.620	Q32M45.pdb.gz	ANO4_HUMAN Anoctamin-4 OS=Homo sapiens OX=9606 GN=ANO4 PE=2 SV=1
3	AFDB:Q75UR0	0.772	0.836	8.025E-72	904	0.382	0.415	Q75UR0.pdb.gz	ANO5_MOUSE Anoctamin-5 OS=Mus musculus OX=10090 GN=Ano5 PE=2 SV=1
4	AFDB:Q75V66	0.770	0.826	3.521E-71	913	0.384	0.413	Q75V66.pdb.gz	ANO5_HUMAN Anoctamin-5 OS=Homo sapiens OX=9606 GN=ANO5 PE=1 SV=1
5	AFDB:Q9NQ90	0.759	0.743	2.599E-69	1003	0.382	0.374	Q9NQ90.pdb.gz	ANO2_HUMAN Anoctamin-2 OS=Homo sapiens OX=9606 GN=ANO2 PE=1 SV=2
6	AFDB:Q5XXA6	0.757	0.753	3.401E-69	986	0.381	0.379	Q5XXA6.pdb.gz	ANO1_HUMAN Anoctamin-1 OS=Homo sapiens OX=9606 GN=ANO1 PE=1 SV=1
7	AFDB:A0A0B4JCY1	0.763	0.683	8.652E-66	1099	0.363	0.324	A0A0B4JCY1.pdb.gz	A0A0B4JCY1_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
8	AFDB:Q14AT5	0.756	0.861	9.559E-64	859	0.336	0.384	Q14AT5.pdb.gz	ANO7_MOUSE Anoctamin-7 OS=Mus musculus OX=10090 GN=Ano7 PE=1 SV=2
9	AFDB:Q6IWH7	0.751	0.788	1.872E-63	933	0.332	0.349	Q6IWH7.pdb.gz	ANO7_HUMAN Anoctamin-7 OS=Homo sapiens OX=9606 GN=ANO7 PE=1 SV=2
10	PDB:8b8kA	0.683	0.896	8.712E-59	741	0.353	0.467	8b8kA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
11	PDB:8b8jA	0.629	0.859	6.275E-53	709	0.345	0.477	8b8jA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
12	AFDB:A1A5B4	0.665	0.828	1.033E-52	782	0.307	0.385	A1A5B4.pdb.gz	ANO9_HUMAN Anoctamin-9 OS=Homo sapiens OX=9606 GN=ANO9 PE=1 SV=3
13	PDB:7zk3A	0.672	0.904	2.753E-52	721	0.322	0.438	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
14	PDB:8b8mB	0.622	0.884	1.553E-50	682	0.333	0.479	8b8mB.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
15	PDB:7b5dA	0.634	0.872	2.938E-48	701	0.314	0.439	7b5dA.pdb.gz
16	PDB:8bc0B	0.591	0.896	1.474E-47	636	0.315	0.486	8bc0B.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
17	PDB:6p47A	0.653	0.871	1.051E-43	725	0.350	0.473	6p47A.pdb.gz
18	PDB:8bc1A	0.509	0.930	1.283E-39	527	0.279	0.520	8bc1A.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
19	PDB:6r7xA	0.513	0.773	1.576E-25	629	0.175	0.273	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
20	PDB:6bgiA	0.445	0.817	1.063E-23	510	0.254	0.488	6bgiA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4JCY1	563	1099	0.346	0.308	A0A0B4JCY1_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
2	A0A0B4KGH4	562	950	0.346	0.357	A0A0B4KGH4_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
3	A0A0G2JU76	614	903	0.334	0.363	A0A0G2JU76_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=2
4	A0A0G2JXB5	641	1002	0.363	0.355	A0A0G2JXB5_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=2
5	A0A0G2K052	644	1039	0.368	0.347	A0A0G2K052_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=2
6	A0A0G2K1M7	690	909	0.385	0.416	A0A0G2K1M7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
7	A0A8I5Y1S2	690	924	0.385	0.409	A0A8I5Y1S2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
8	A0A8I5ZNW7	651	1040	0.367	0.346	A0A8I5ZNW7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=1
9	A0A8I5ZRU7	691	911	0.385	0.415	A0A8I5ZRU7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
10	A0A8I6AA94	690	932	0.385	0.406	A0A8I6AA94_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
11	A0A8I6AHD2	691	865	0.385	0.437	A0A8I6AHD2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
12	A0A8I6ASC3	691	888	0.385	0.426	A0A8I6ASC3_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
13	A0A8I6G530	691	887	0.385	0.426	A0A8I6G530_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
14	A0A8I6GJA0	637	911	0.361	0.389	A0A8I6GJA0_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=1
15	A0A8I6GL36	605	990	0.353	0.349	A0A8I6GL36_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=1
16	A2AHL1	1899	981	0.937	0.937	ANO3_MOUSE Anoctamin-3 OS=Mus musculus OX=10090 GN=Ano3 PE=1 SV=1
17	D4A915	640	1040	0.368	0.347	D4A915_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=3 SV=1
18	F1M0A0	1905	981	0.940	0.940	F1M0A0_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano3 PE=3 SV=4
19	F1M3G8	642	936	0.365	0.382	F1M3G8_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=3
20	F1QNZ8	632	910	0.369	0.398	F1QNZ8_DANRE Anoctamin OS=Danio rerio OX=7955 GN=ano6 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04547 Anoctamin	1.1e-152	520.9	Calcium-activated chloride channel
2	PF16178 Anoct_dimer	1.8e-70	248.6	Dimerisation domain of Ca+-activated chloride-channel, anoctamin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256737

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000439244	0.804	Cip1-interacting zinc finger protein
2	9606.ENSP00000254250	0.776	THAP domain-containing protein 1
3	9606.ENSP00000334051	0.773	Guanine nucleotide-binding protein G(olf) subunit alpha
4	9606.ENSP00000345719	0.681	Torsin-1A
5	9606.ENSP00000444688	0.678	Sodium/potassium-transporting ATPase subunit alpha-3
6	9606.ENSP00000398930	0.662	Epsilon-sarcoglycan
7	9606.ENSP00000390111	0.649	Phospholipid scramblase family member 5
8	9606.ENSP00000438547	0.644	Phospholipid scramblase 3
9	9606.ENSP00000385096	0.641	BTB/POZ domain-containing protein KCTD17
10	9606.ENSP00000348453	0.608	Anoctamin-2
11	9606.ENSP00000319486	0.606	Tetraspanin-16
12	9606.ENSP00000362566	0.604	Neuron-specific calcium-binding protein hippocalcin
13	9606.ENSP00000264071	0.596	Tubulin beta-4A chain
14	9606.ENSP00000456226	0.595	Interferon induced transmembrane protein domain containing
15	9606.ENSP00000360822	0.569	Potassium channel subfamily T member 1
16	9606.ENSP00000356780	0.568	Coiled-coil domain-containing protein 181
17	9606.ENSP00000318176	0.566	Interferon-inducible double-stranded RNA-dependent protein kinase activator A
18	9606.ENSP00000273077	0.565	Probable hydrolase PNKD
19	9606.ENSP00000347038	0.554	Phospholipid scramblase 4
20	9606.ENSP00000216127	0.552	GTP-binding protein Rhes

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017128	1.000	phospholipid scramblase activity
GO:0005229	1.000	intracellular calcium activated chloride channel activity
GO:0005515	0.971	protein binding
GO:0005244	0.775	voltage-gated monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0065007	0.965	biological regulation
GO:0051179	0.937	localization
GO:0006810	0.934	transport
GO:0006811	0.903	monoatomic ion transport
GO:0050896	0.840	response to stimulus
GO:0065008	0.772	regulation of biological quality
GO:0034220	0.730	monoatomic ion transmembrane transport
GO:0071840	0.658	cellular component organization or biogenesis
GO:0051606	0.655	detection of stimulus
GO:0016043	0.645	cellular component organization
GO:0071702	0.606	organic substance transport
GO:0009582	0.597	detection of abiotic stimulus
GO:0009581	0.597	detection of external stimulus
GO:0050789	0.586	regulation of biological process
GO:0010256	0.554	endomembrane system organization
GO:0010876	0.549	lipid localization
GO:0016048	0.546	detection of temperature stimulus
GO:0097035	0.525	regulation of membrane lipid distribution
GO:0007009	0.518	plasma membrane organization
GO:0050794	0.481	regulation of cellular process
GO:0009612	0.416	response to mechanical stimulus
GO:0015914	0.416	phospholipid transport
GO:0032501	0.312	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)

[back to server]