StarFunc result for job id Q9BYV1

User Input

>input (514 residues)
MTLIWRHLLRPLCLVTSAPRILEMHPFLSLGTSRTSVTKLSLHTKPRMPPCDFMPERYQS
LGYNRVLEIHKEHLSPVVTAYFQKPLLLHQGHMEWLFDAEGSRYLDFFSGIVTVSVGHCH
PKVNAVAQKQLGRLWHTSTVFFHPPMHEYAEKLAALLPEPLKVIFLVNSGSEANELAMLM
ARAHSNNIDIISFRGAYHGCSPYTLGLTNVGTYKMELPGGTGCQPTMCPDVFRGPWGGSH
CRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPK
GFLKEAFELVRARGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAA
VITTPEIAKSLAKCLQHFNTFGGNPMACAIGSAVLEVIKEENLQENSQEVGTYMLLKFAK
LRDEFEIVGDVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQT
FRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYV1	1.000	1.000	0.000	514	1.000	1.000	Q9BYV1.pdb.gz	AGT2_HUMAN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AGXT2 PE=1 SV=1
2	AFDB:Q3UEG6	0.932	0.934	4.343E-98	513	0.848	0.850	Q3UEG6.pdb.gz	AGT2_MOUSE Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Agxt2 PE=1 SV=1
3	AFDB:Q9SR86	0.847	0.905	2.141E-60	481	0.393	0.420	Q9SR86.pdb.gz	AGT23_ARATH Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g08860 PE=2 SV=1
4	AFDB:Q940M2	0.857	0.925	6.944E-60	476	0.412	0.445	Q940M2.pdb.gz	AGT21_ARATH Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT2 PE=1 SV=1
5	AFDB:Q94AL9	0.847	0.912	1.481E-58	477	0.379	0.409	Q94AL9.pdb.gz	AGT22_ARATH Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT3 PE=1 SV=2
6	AFDB:Q9VU95	0.800	0.831	1.996E-51	494	0.321	0.334	Q9VU95.pdb.gz	AGT2L_DROME Alanine--glyoxylate aminotransferase 2-like OS=Drosophila melanogaster OX=7227 GN=CG8745 PE=2 SV=2
7	AFDB:Q7SY54	0.814	0.849	9.624E-49	492	0.311	0.325	Q7SY54.pdb.gz	AT2L1_DANRE Ethanolamine-phosphate phospho-lyase OS=Danio rerio OX=7955 GN=etnppl PE=2 SV=1
8	AFDB:Q8TBG4	0.794	0.818	4.999E-48	499	0.313	0.323	Q8TBG4.pdb.gz	AT2L1_HUMAN Ethanolamine-phosphate phospho-lyase OS=Homo sapiens OX=9606 GN=ETNPPL PE=1 SV=1
9	AFDB:Q8IUZ5	0.797	0.908	2.898E-46	450	0.284	0.324	Q8IUZ5.pdb.gz	AT2L2_HUMAN 5-phosphohydroxy-L-lysine phospho-lyase OS=Homo sapiens OX=9606 GN=PHYKPL PE=1 SV=1
10	AFDB:Q8R1K4	0.796	0.874	7.430E-46	467	0.288	0.317	Q8R1K4.pdb.gz	AT2L2_MOUSE 5-phosphohydroxy-L-lysine phospho-lyase OS=Mus musculus OX=10090 GN=Phykpl PE=1 SV=1
11	PDB:6torB	0.731	0.924	1.094E-44	404	0.296	0.376	6torB.pdb.gz	Structural characterization of human O-phosphoethanolamine phospho-lyase.
12	PDB:1sf2A	0.775	0.931	2.885E-40	425	0.245	0.296	1sf2A.pdb.gz	Crystal structures of unbound and aminooxyacetate-bound Escherichia coli gamma-aminobutyrate aminotransferase.
13	PDB:7jh3A	0.770	0.937	4.043E-38	420	0.220	0.269	7jh3A.pdb.gz
14	PDB:5h7dA	0.730	0.757	1.475E-37	495	0.255	0.265	5h7dA.pdb.gz	Construction of novel repeat proteins with rigid and predictable structures using a shared helix method.
15	PDB:2byjA	0.695	0.875	3.981E-36	404	0.232	0.295	2byjA.pdb.gz	Determinants of Substrate Specificity in Omega-Aminotransferases.
16	PDB:4a6tC	0.764	0.859	1.529E-34	455	0.214	0.242	4a6tC.pdb.gz	Crystal Structures of the Chromobacterium Violaceum Omega-Transaminase Reveal Major Structural Rearrangements Upon Binding of Coenzyme Plp.
17	PDB:4adbB	0.694	0.879	1.621E-34	401	0.222	0.284	4adbB.pdb.gz	Determination of the Structure of the Catabolic N-Succinylornithine Transaminase (Astc) from Escherichia Coli.
18	PDB:3ntjB	0.666	0.860	3.260E-33	393	0.210	0.275	3ntjB.pdb.gz
19	PDB:4b98A	0.736	0.852	5.219E-33	441	0.224	0.261	4b98A.pdb.gz	Structural Studies with Pseudomonas and Chromobacterium [Omega]-Aminotransferases Provide Insights Into Their Differing Substrate Specificity.
20	PDB:1dtyA	0.709	0.842	2.410E-32	429	0.214	0.256	1dtyA.pdb.gz	Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UEG6	0.0	917	513	0.848	0.850	AGT2_MOUSE Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Agxt2 PE=1 SV=1
2	Q64565	0.0	889	512	0.831	0.834	AGT2_RAT Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Agxt2 PE=1 SV=2
3	Q9BYV1	0.0	1073	514	1.000	1.000	AGT2_HUMAN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AGXT2 PE=1 SV=1
4	Q940M2	4.31e-140	414	476	0.411	0.443	AGT21_ARATH Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT2 PE=1 SV=1
5	Q9SR86	3.43e-133	396	481	0.385	0.412	AGT23_ARATH Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g08860 PE=2 SV=1
6	Q94AL9	4.38e-125	375	477	0.375	0.405	AGT22_ARATH Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AGT3 PE=1 SV=2
7	Q9VU95	3.80e-96	302	494	0.329	0.342	AGT2L_DROME Alanine--glyoxylate aminotransferase 2-like OS=Drosophila melanogaster OX=7227 GN=CG8745 PE=2 SV=2
8	Q7SY54	2.99e-92	291	492	0.327	0.341	AT2L1_DANRE Ethanolamine-phosphate phospho-lyase OS=Danio rerio OX=7955 GN=etnppl PE=2 SV=1
9	Q8TBG4	5.75e-89	283	499	0.315	0.325	AT2L1_HUMAN Ethanolamine-phosphate phospho-lyase OS=Homo sapiens OX=9606 GN=ETNPPL PE=1 SV=1
10	Q8R1K4	1.18e-82	266	467	0.298	0.328	AT2L2_MOUSE 5-phosphohydroxy-L-lysine phospho-lyase OS=Mus musculus OX=10090 GN=Phykpl PE=1 SV=1
11	Q8IUZ5	6.71e-79	256	450	0.286	0.327	AT2L2_HUMAN 5-phosphohydroxy-L-lysine phospho-lyase OS=Homo sapiens OX=9606 GN=PHYKPL PE=1 SV=1
12	Q9US34	3.77e-58	201	448	0.267	0.306	YFZ7_SCHPO Uncharacterized aminotransferase C1039.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1039.07c PE=3 SV=1
13	Q9I6M4	1.52e-55	194	426	0.261	0.315	DAVT_PSEAE 5-aminovalerate aminotransferase DavT OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=davT PE=1 SV=1
14	P94427	9.75e-54	189	436	0.257	0.303	GABT_BACSU Probable 4-aminobutyrate aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=gabT PE=3 SV=1
15	Q88RB9	3.33e-51	182	425	0.259	0.313	DAVT_PSEPK 5-aminovalerate aminotransferase DavT OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=davT PE=1 SV=1
16	E0SIE8	1.07e-50	182	471	0.267	0.291	E0SIE8_DICD3 4-aminobutyrate aminotransferase OS=Dickeya dadantii (strain 3937) OX=198628 GN=acsF PE=3 SV=1
17	O30508	1.25e-47	172	406	0.243	0.308	ARUC_PSEAE Succinylornithine transaminase/acetylornithine aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=aruC PE=1 SV=2
18	P38021	2.92e-47	171	401	0.249	0.319	OAT_BACSU Ornithine aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=rocD PE=1 SV=2
19	P77581	3.51e-47	171	406	0.245	0.310	ASTC_ECOLI Succinylornithine transaminase OS=Escherichia coli (strain K12) OX=83333 GN=astC PE=1 SV=1
20	P22256	3.85e-47	171	426	0.253	0.305	GABT_ECOLI 4-aminobutyrate aminotransferase GabT OS=Escherichia coli (strain K12) OX=83333 GN=gabT PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00202 Aminotran_3	2.4e-84	295.0	Aminotransferase class-III

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231420

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302620	0.998	Alanine-glyoxylate aminotransferase
2	9606.ENSP00000379845	0.984	4-aminobutyrate aminotransferase, mitochondrial
3	9606.ENSP00000387123	0.984	Alpha-aminoadipic semialdehyde dehydrogenase
4	9606.ENSP00000370737	0.966	Glycine dehydrogenase (decarboxylating), mitochondrial
5	9606.ENSP00000261733	0.964	Aldehyde dehydrogenase, mitochondrial
6	9606.ENSP00000366927	0.960	Aldehyde dehydrogenase X, mitochondrial
7	9606.ENSP00000265395	0.954	3-hydroxyisobutyrate dehydrogenase, mitochondrial
8	9606.ENSP00000345282	0.954	Alanine aminotransferase 2
9	9606.ENSP00000378408	0.952	Alanine aminotransferase 1
10	9606.ENSP00000346827	0.944	4-trimethylaminobutyraldehyde dehydrogenase
11	9606.ENSP00000379895	0.941	Glycine amidinotransferase, mitochondrial
12	9606.ENSP00000317721	0.940	Peroxisomal sarcosine oxidase
13	9606.ENSP00000318868	0.936	Serine hydroxymethyltransferase, cytosolic
14	9606.ENSP00000360938	0.933	Sarcosine dehydrogenase, mitochondrial
15	9606.ENSP00000333667	0.931	Serine hydroxymethyltransferase, mitochondrial
16	9606.ENSP00000231887	0.930	Peroxisomal bifunctional enzyme
17	9606.ENSP00000324343	0.930	Beta-ureidopropionase
18	9606.ENSP00000363832	0.929	Aldehyde oxidase
19	9606.ENSP00000345774	0.928	Fatty aldehyde dehydrogenase
20	9606.ENSP00000450436	0.928	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008483	1.000	transaminase activity
GO:0005488	0.977	binding
GO:0005515	0.822	protein binding
GO:0097159	0.586	organic cyclic compound binding
GO:1901363	0.582	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044281	0.996	small molecule metabolic process
GO:0044238	0.992	primary metabolic process
GO:0019752	0.992	carboxylic acid metabolic process
GO:0009063	0.975	amino acid catabolic process
GO:1901605	0.964	alpha-amino acid metabolic process
GO:0032787	0.880	monocarboxylic acid metabolic process
GO:0009069	0.743	serine family amino acid metabolic process
GO:0006544	0.651	glycine metabolic process
GO:0009058	0.635	biosynthetic process
GO:0044249	0.549	cellular biosynthetic process
GO:1901576	0.527	organic substance biosynthetic process
GO:1901606	0.478	alpha-amino acid catabolic process
GO:1901566	0.416	organonitrogen compound biosynthetic process
GO:0065007	0.387	biological regulation
GO:0046394	0.381	carboxylic acid biosynthetic process
GO:0050789	0.354	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.874	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.6.1.-	1.000	Transaminases.

[back to server]