StarFunc result for job id Q9BYV2

User Input

>input (358 residues)
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKA
EQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAM
LVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQE
EKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAG
RPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ERP3	0.925	0.905	3.818E-57	366	0.955	0.934	Q9ERP3.pdb.gz	TRI54_MOUSE Tripartite motif-containing protein 54 OS=Mus musculus OX=10090 GN=Trim54 PE=1 SV=1
2	AFDB:Q9BYV6	0.781	0.529	5.569E-42	548	0.626	0.409	Q9BYV6.pdb.gz	TRI55_HUMAN Tripartite motif-containing protein 55 OS=Homo sapiens OX=9606 GN=TRIM55 PE=1 SV=2
3	AFDB:Q969Q1	0.715	0.724	3.623E-41	353	0.589	0.598	Q969Q1.pdb.gz	TRI63_HUMAN E3 ubiquitin-protein ligase TRIM63 OS=Homo sapiens OX=9606 GN=TRIM63 PE=1 SV=1
4	AFDB:G3X8Y1	0.800	0.542	2.219E-40	545	0.628	0.413	G3X8Y1.pdb.gz	G3X8Y1_MOUSE Tripartite motif-containing 55 OS=Mus musculus OX=10090 GN=Trim55 PE=1 SV=1
5	AFDB:Q9UJV3	0.452	0.246	4.552E-22	735	0.260	0.127	Q9UJV3.pdb.gz	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
6	AFDB:O70583	0.486	0.271	1.061E-21	680	0.263	0.138	O70583.pdb.gz	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
7	AFDB:Q80WG7	0.288	0.155	5.065E-20	729	0.288	0.141	Q80WG7.pdb.gz	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
8	AFDB:Q8C7M3	0.406	0.210	1.913E-19	817	0.251	0.110	Q8C7M3.pdb.gz	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
9	AFDB:Q91ZY8	0.396	0.231	2.920E-19	710	0.251	0.127	Q91ZY8.pdb.gz	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
10	AFDB:A0A0G2JXN2	0.300	0.158	1.788E-18	759	0.277	0.130	A0A0G2JXN2.pdb.gz	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
11	PDB:7z36B	0.456	0.378	4.191E-10	446	0.148	0.119	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
12	PDB:4tn3B	0.351	0.348	4.017E-4	362	0.092	0.091	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
13	PDB:4r8pL	0.188	0.254	7.808E-4	254	0.075	0.106	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
14	PDB:7od1A	0.135	0.115	1.919E-2	430	0.073	0.060	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
15	PDB:7jzvA	0.186	0.255	2.443E-2	253	0.070	0.099	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
16	PDB:5dkaA	0.138	0.427	2.595E-2	96	0.075	0.281	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
17	PDB:7qcdC	0.183	0.237	2.757E-2	267	0.061	0.082	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
18	PDB:4kblA	0.126	0.115	3.510E-2	395	0.073	0.066	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
19	PDB:7oniH	0.137	0.130	3.510E-2	380	0.145	0.137	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
20	PDB:8a3tU	0.129	0.357	4.470E-2	114	0.059	0.184	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BYV2	0.0	736	358	1.000	1.000	TRI54_HUMAN Tripartite motif-containing protein 54 OS=Homo sapiens OX=9606 GN=TRIM54 PE=1 SV=3
2	Q9ERP3	0.0	701	366	0.955	0.934	TRI54_MOUSE Tripartite motif-containing protein 54 OS=Mus musculus OX=10090 GN=Trim54 PE=1 SV=1
3	G3X8Y1	8.72e-158	455	545	0.609	0.400	G3X8Y1_MOUSE Tripartite motif-containing 55 OS=Mus musculus OX=10090 GN=Trim55 PE=1 SV=1
4	Q9BYV6	3.33e-157	454	548	0.601	0.392	TRI55_HUMAN Tripartite motif-containing protein 55 OS=Homo sapiens OX=9606 GN=TRIM55 PE=1 SV=2
5	Q91Z63	1.53e-151	432	351	0.578	0.590	TRI63_RAT E3 ubiquitin-protein ligase TRIM63 OS=Rattus norvegicus OX=10116 GN=Trim63 PE=2 SV=1
6	Q38HM4	6.36e-150	428	350	0.575	0.589	TRI63_MOUSE E3 ubiquitin-protein ligase TRIM63 OS=Mus musculus OX=10090 GN=Trim63 PE=1 SV=1
7	Q969Q1	5.00e-149	426	353	0.561	0.569	TRI63_HUMAN E3 ubiquitin-protein ligase TRIM63 OS=Homo sapiens OX=9606 GN=TRIM63 PE=1 SV=1
8	Q8C6Y1	1.52e-111	325	197	0.422	0.766	Q8C6Y1_MOUSE Tripartite motif-containing protein 55 (Fragment) OS=Mus musculus OX=10090 GN=Trim55 PE=2 SV=1
9	Q80WG7	1.07e-38	148	729	0.332	0.163	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
10	Q9NQ86	1.99e-38	147	728	0.324	0.159	TRI36_HUMAN E3 ubiquitin-protein ligase TRIM36 OS=Homo sapiens OX=9606 GN=TRIM36 PE=1 SV=2
11	Q7TNM2	7.63e-36	140	759	0.304	0.144	TRI46_MOUSE Tripartite motif-containing protein 46 OS=Mus musculus OX=10090 GN=Trim46 PE=1 SV=1
12	A0A0G2JXN2	1.11e-35	139	759	0.304	0.144	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
13	C9J453	8.41e-32	126	483	0.260	0.193	C9J453_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
14	O15344	1.65e-31	127	667	0.260	0.139	TRI18_HUMAN E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
15	O70583	3.41e-31	126	680	0.263	0.138	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
16	Q9UJV3	3.53e-28	117	735	0.257	0.125	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
17	O75382	1.97e-20	95.1	744	0.201	0.097	TRIM3_HUMAN Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3 PE=1 SV=2
18	Q9CYB0	2.05e-20	93.6	407	0.218	0.192	TRI13_MOUSE E3 ubiquitin-protein ligase TRIM13 OS=Mus musculus OX=10090 GN=Trim13 PE=2 SV=1
19	Q9R1R2	3.37e-20	94.4	744	0.198	0.095	TRIM3_MOUSE Tripartite motif-containing protein 3 OS=Mus musculus OX=10090 GN=Trim3 PE=1 SV=1
20	O70277	4.02e-20	94.0	744	0.198	0.095	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07223 DUF1421	5.3e+02	11.9	UBA-like domain (DUF1421)
2	PF03993 DUF349	39	15.9	Domain of Unknown Function (DUF349)
3	PF19113 DUF5799	7.6e+02	11.8	Family of unknown function (DUF5799)
4	PF10359 Fmp27_WPPW	1.5e+02	12.7	RNA pol II promoter Fmp27 protein domain
5	PF02811 PHP	2e+02	13.8	PHP domain
6	PF09548 Spore_III_AB	6.8e+02	11.8	Stage III sporulation protein AB (spore_III_AB)
7	PF13361 UvrD_C	1e+02	13.8	UvrD-like helicase C-terminal domain
8	PF00643 zf-B_box	0.012	27.1	B-box zinc finger
9	PF00097 zf-C3HC4	0.00097	30.3	Zinc finger, C3HC4 type (RING finger)
10	PF13923 zf-C3HC4_2	4.6e-05	34.4	Zinc finger, C3HC4 type (RING finger)
11	PF13920 zf-C3HC4_3	0.047	24.9	Zinc finger, C3HC4 type (RING finger)
12	PF15227 zf-C3HC4_4	0.035	25.5	zinc finger of C3HC4-type, RING
13	PF13639 zf-RING_2	0.009	27.7	Ring finger domain
14	PF14634 zf-RING_5	0.0016	29.7	zinc-RING finger domain
15	PF14835 zf-RING_6	0.3	22.3	zf-RING of BARD1-type protein
16	PF13445 zf-RING_UBOX	2.9e-07	41.7	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003827150.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008966737.1	0.820	Titin
2	9597.XP_008966763.1	0.758	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 51% coverage of the annotated genomic feature by RNAseq alignments
3	9597.XP_008958403.1	0.706	Belongs to the histone H2B family.
4	9597.XP_003804484.2	0.610	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
5	9597.XP_008957187.1	0.600	Forkhead box protein O1
6	9597.XP_003820689.1	0.572	Muscle related coiled-coil protein
7	9597.XP_003845992.2	0.572	Forkhead box protein O3
8	9597.XP_008954145.1	0.571	Gamma-butyrobetaine hydroxylase 1
9	9597.XP_008969632.1	0.562	Tripartite motif-containing protein 66
10	9597.XP_008952747.1	0.561	Nuclear receptor subfamily 3 group C member 1
11	9597.XP_008955062.1	0.557	Titin-cap
12	9597.XP_003820527.1	0.551	F-box only protein 32
13	9597.XP_003832649.1	0.543	Solute carrier family 17 member 8
14	9597.XP_003827247.1	0.532	SMAD family member 2
15	9597.XP_008958015.1	0.532	Belongs to the ubiquitin-conjugating enzyme family.
16	9597.XP_003828052.1	0.526	SMAD family member 3
17	9597.XP_003825956.1	0.510	MYB proto-oncogene like 2
18	9597.XP_008950853.1	0.510	SMAD family member 4
19	9597.XP_003813976.1	0.509	NBR1, autophagy cargo receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.876	cytoskeletal protein binding
GO:0003824	0.867	catalytic activity
GO:0016740	0.560	transferase activity
GO:0015631	0.438	tubulin binding
GO:0008017	0.434	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.985	regulation of cellular process
GO:0048519	0.880	negative regulation of biological process
GO:1902903	0.788	regulation of supramolecular fiber organization
GO:0019222	0.785	regulation of metabolic process
GO:0051494	0.764	negative regulation of cytoskeleton organization
GO:0009987	0.721	cellular process
GO:0032886	0.695	regulation of microtubule-based process
GO:1901879	0.682	regulation of protein depolymerization
GO:0043242	0.682	negative regulation of protein-containing complex disassembly
GO:0031110	0.682	regulation of microtubule polymerization or depolymerization
GO:0048518	0.670	positive regulation of biological process
GO:1902904	0.657	negative regulation of supramolecular fiber organization
GO:0060255	0.626	regulation of macromolecule metabolic process
GO:0010468	0.610	regulation of gene expression
GO:0050896	0.598	response to stimulus
GO:0031111	0.562	negative regulation of microtubule polymerization or depolymerization
GO:1901880	0.561	negative regulation of protein depolymerization
GO:0007026	0.551	negative regulation of microtubule depolymerization
GO:0051171	0.512	regulation of nitrogen compound metabolic process
GO:0080090	0.510	regulation of primary metabolic process
GO:0048522	0.497	positive regulation of cellular process
GO:0031323	0.495	regulation of cellular metabolic process
GO:0032501	0.483	multicellular organismal process
GO:0008152	0.467	metabolic process
GO:0071704	0.418	organic substance metabolic process
GO:0019219	0.396	regulation of nucleobase-containing compound metabolic process
GO:0042221	0.390	response to chemical
GO:0044238	0.384	primary metabolic process
GO:0051252	0.372	regulation of RNA metabolic process
GO:0006807	0.361	nitrogen compound metabolic process
GO:0043170	0.359	macromolecule metabolic process
GO:0044237	0.358	cellular metabolic process
GO:0010556	0.340	regulation of macromolecule biosynthetic process
GO:0031326	0.340	regulation of cellular biosynthetic process
GO:0010033	0.337	response to organic substance
GO:0006355	0.332	regulation of DNA-templated transcription
GO:0010604	0.328	positive regulation of macromolecule metabolic process
GO:0051716	0.312	cellular response to stimulus
GO:0044260	0.302	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0032991	0.993	protein-containing complex
GO:0005737	0.961	cytoplasm
GO:0005829	0.952	cytosol
GO:0043233	0.885	organelle lumen
GO:0031981	0.879	nuclear lumen
GO:0005856	0.871	cytoskeleton
GO:0005654	0.733	nucleoplasm
GO:0015630	0.570	microtubule cytoskeleton
GO:0005875	0.454	microtubule associated complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.560	Transferases.

[back to server]