StarFunc result for job id Q9BYV9

User Input

>input (841 residues)
MSVDEKPDSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSE
YFWQALVGQTKNDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMHN
LEDSCFSFLQTQLLNSEDGLFVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMAC
PRDQMLPEPISFEAAAIPVAEKEEALLPEPDVPTDTKESSEKDALTQYPRYKKYQLACTK
NVYNASSHSTSGFASTFREDNSSNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDA
KDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITKSVELSGLPSTS
QQHFARSPACPFDKGITQGDLKTDYTPFTGNYGQPHVGQKEVSNFTMGSPLRGPGLEALC
KQEGELDRRSVIFSSSACDQVSTSVHSYSGVSSLDKDLSEPVPKGLWVGAGQSLPSSQAY
SHGGLMADHLPGRMRPNTSCPVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSPCSL
PLCEFSSSPCSQGARFLATEHQEPGLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFSEAD
SESCPVQDRGQEVKLPFPVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDVRRRSKNRIAA
QRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDIQSP
EQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCLEPGAAPPGPP
WAPSNTSENCTSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDY
T

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYV9	0.999	0.999	0.000	841	1.000	1.000	Q9BYV9.pdb.gz	BACH2_HUMAN Transcription regulator protein BACH2 OS=Homo sapiens OX=9606 GN=BACH2 PE=1 SV=1
2	AFDB:P97302	0.284	0.317	3.887E-40	739	0.338	0.384	P97302.pdb.gz	BACH1_MOUSE Transcription regulator protein BACH1 OS=Mus musculus OX=10090 GN=Bach1 PE=1 SV=1
3	AFDB:Q7JN04	0.142	0.111	1.843E-13	1085	0.146	0.113	Q7JN04.pdb.gz	Q7JN04_DROME Pipsqueak protein OS=Drosophila melanogaster OX=7227 GN=psq PE=4 SV=1
4	AFDB:Q24174	0.159	0.148	8.479E-13	904	0.166	0.155	Q24174.pdb.gz	ABRU_DROME Protein abrupt OS=Drosophila melanogaster OX=7227 GN=ab PE=1 SV=2
5	AFDB:Q24206	0.132	0.126	3.025E-12	880	0.145	0.139	Q24206.pdb.gz	BRC4_DROME Broad-complex core protein isoform 6 OS=Drosophila melanogaster OX=7227 GN=br PE=1 SV=2
6	AFDB:O15062	0.123	0.151	1.886E-10	677	0.121	0.151	O15062.pdb.gz	ZBTB5_HUMAN Zinc finger and BTB domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBTB5 PE=1 SV=1
7	AFDB:B2RXH4	0.131	0.154	3.343E-10	712	0.137	0.162	B2RXH4.pdb.gz	BTBDI_HUMAN BTB/POZ domain-containing protein 18 OS=Homo sapiens OX=9606 GN=BTBD18 PE=1 SV=1
8	AFDB:P42283	0.134	0.127	5.560E-10	891	0.141	0.134	P42283.pdb.gz	LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=2
9	AFDB:Q867Z4	0.134	0.116	1.050E-9	970	0.143	0.124	Q867Z4.pdb.gz	LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=1
10	AFDB:M9NEG1	0.154	0.118	1.861E-9	1109	0.133	0.101	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
11	PDB:6wcqC	0.131	0.777	2.282E-7	130	0.040	0.262	6wcqC.pdb.gz
12	PDB:7mk2A	0.118	0.261	1.811E-4	354	0.031	0.073	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:7phhA	0.091	0.176	4.875E-2	396	0.019	0.040	7phhA.pdb.gz
14	PDB:6sgaFS	0.076	0.205	6.287E-2	277	0.024	0.072	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
15	PDB:7sszA	0.090	0.181	2.243E-1	362	0.014	0.033	7sszA.pdb.gz
16	PDB:2a79B	0.071	0.187	2.714E-1	259	0.021	0.069	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
17	PDB:3lutB	0.091	0.174	2.892E-1	390	0.018	0.038	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
18	PDB:7f3fA	0.093	0.157	3.500E-1	460	0.021	0.039	7f3fA.pdb.gz
19	PDB:7sizB	0.087	0.194	4.235E-1	334	0.015	0.039	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
20	PDB:7w6sB	0.089	0.157	5.126E-1	448	0.018	0.033	7w6sB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97303	0.0	1460	839	0.901	0.903	BACH2_MOUSE Transcription regulator protein BACH2 OS=Mus musculus OX=10090 GN=Bach2 PE=1 SV=3
2	Q9BYV9	0.0	1731	841	1.000	1.000	BACH2_HUMAN Transcription regulator protein BACH2 OS=Homo sapiens OX=9606 GN=BACH2 PE=1 SV=1
3	P97302	1.15e-49	189	739	0.102	0.116	BACH1_MOUSE Transcription regulator protein BACH1 OS=Mus musculus OX=10090 GN=Bach1 PE=1 SV=1
4	O14867	1.76e-47	183	736	0.094	0.107	BACH1_HUMAN Transcription regulator protein BACH1 OS=Homo sapiens OX=9606 GN=BACH1 PE=1 SV=2
5	Q502I2	2.51e-38	142	162	0.080	0.414	Q502I2_DANRE BTB and CNC homology 1, basic leucine zipper transcription factor 1 OS=Danio rerio OX=7955 GN=bach1 PE=2 SV=1
6	F1R5N6	1.16e-21	103	718	0.068	0.079	F1R5N6_DANRE B-cell lymphoma 6 protein isoform X2 OS=Danio rerio OX=7955 GN=bcl6 PE=4 SV=1
7	Q6PC08	1.23e-21	102	704	0.068	0.081	Q6PC08_DANRE B-cell CLL/lymphoma 6 (Zinc finger protein 51) OS=Danio rerio OX=7955 GN=bcl6 PE=2 SV=1
8	P41183	5.09e-21	100	707	0.057	0.068	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
9	Q8JIM1	5.67e-21	100	586	0.055	0.078	Q8JIM1_DANRE Nuclear factor erythroid 2-related factor 2 OS=Danio rerio OX=7955 GN=nrf2 PE=2 SV=1
10	P41182	7.12e-21	100	706	0.057	0.068	BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens OX=9606 GN=BCL6 PE=1 SV=1
11	Q16621	8.86e-20	94.4	373	0.049	0.110	NFE2_HUMAN Transcription factor NF-E2 45 kDa subunit OS=Homo sapiens OX=9606 GN=NFE2 PE=1 SV=1
12	Q8N143	1.44e-19	95.1	479	0.061	0.106	BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens OX=9606 GN=BCL6B PE=2 SV=2
13	A8KA13	1.45e-19	95.1	480	0.061	0.106	A8KA13_HUMAN B-cell CLL/lymphoma 6, member B (Zinc finger protein), isoform CRA_a OS=Homo sapiens OX=9606 GN=BCL6B PE=1 SV=1
14	Q07279	1.72e-19	93.6	373	0.049	0.110	NFE2_MOUSE Transcription factor NF-E2 45 kDa subunit OS=Mus musculus OX=10090 GN=Nfe2 PE=1 SV=1
15	Q8NCP5	2.29e-19	95.1	570	0.058	0.086	ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens OX=9606 GN=ZBTB44 PE=1 SV=1
16	O88282	2.51e-19	94.4	474	0.063	0.112	BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus OX=10090 GN=Bcl6b PE=1 SV=1
17	O88939	4.93e-19	94.0	569	0.055	0.081	ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus OX=10090 GN=Zbtb7a PE=1 SV=2
18	Q9QZ48	6.94e-19	93.6	569	0.055	0.081	ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus OX=10116 GN=Zbtb7a PE=1 SV=1
19	Q60821	1.15e-18	93.6	794	0.058	0.062	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
20	Q13105	1.47e-18	93.2	803	0.058	0.061	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	5.4e-24	95.9	BTB/POZ domain
2	PF00170 bZIP_1	7.8e-06	37.2	bZIP transcription factor
3	PF07716 bZIP_2	0.089	24.2	Basic region leucine zipper
4	PF03131 bZIP_Maf	1.4e-09	49.7	bZIP Maf transcription factor
5	PF14662 KASH_CCD	1.6e+02	13.5	Coiled-coil region of CCDC155 or KASH

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257749

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344903	0.978	Transcription factor MafK
2	9606.ENSP00000327048	0.971	Transcription factor Maf
3	9606.ENSP00000345393	0.907	Transcription factor MafF
4	9606.ENSP00000350369	0.828	Transcription factor MafG
5	9606.ENSP00000358092	0.726	PR domain zinc finger protein 1
6	9606.ENSP00000286639	0.719	Basic leucine zipper transcriptional factor ATF-like
7	9606.ENSP00000350844	0.693	Paired box protein Pax-5
8	9606.ENSP00000370343	0.675	Interferon regulatory factor 4
9	9606.ENSP00000369251	0.654	Putative nucleotidyltransferase MAB21L1
10	9606.ENSP00000253363	0.644	RNA-binding protein 39
11	9606.ENSP00000361027	0.642	Angiomotin
12	9606.ENSP00000299767	0.639	Endoplasmin
13	9606.ENSP00000298229	0.632	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
14	9606.ENSP00000358335	0.628	Mitogen-activated protein kinase kinase kinase 7
15	9606.ENSP00000376786	0.626	POU domain class 2-associating factor 1
16	9606.ENSP00000384018	0.605	Nuclear receptor corepressor 2
17	9606.ENSP00000243440	0.593	Basic leucine zipper transcriptional factor ATF-like 3
18	9606.ENSP00000324173	0.583	78 kDa glucose-regulated protein
19	9606.ENSP00000229335	0.571	Single-stranded DNA cytosine deaminase
20	9606.ENSP00000426503	0.571	E3 ubiquitin-protein ligase RNF4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0000981	0.900	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001067	0.776	transcription regulatory region nucleic acid binding
GO:0000976	0.773	transcription cis-regulatory region binding
GO:0000977	0.596	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0042802	0.448	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0050896	0.982	response to stimulus
GO:0051252	0.979	regulation of RNA metabolic process
GO:0009889	0.978	regulation of biosynthetic process
GO:0006355	0.972	regulation of DNA-templated transcription
GO:0009987	0.948	cellular process
GO:0002376	0.936	immune system process
GO:0006955	0.861	immune response
GO:0051253	0.780	negative regulation of RNA metabolic process
GO:0006357	0.714	regulation of transcription by RNA polymerase II
GO:0010558	0.696	negative regulation of macromolecule biosynthetic process
GO:0031327	0.668	negative regulation of cellular biosynthetic process
GO:0002250	0.621	adaptive immune response
GO:0048518	0.617	positive regulation of biological process
GO:0051179	0.604	localization
GO:0048522	0.580	positive regulation of cellular process
GO:0051641	0.470	cellular localization
GO:0051169	0.426	nuclear transport
GO:0009893	0.416	positive regulation of metabolic process
GO:1902679	0.415	negative regulation of RNA biosynthetic process
GO:0010604	0.402	positive regulation of macromolecule metabolic process
GO:0051173	0.366	positive regulation of nitrogen compound metabolic process
GO:0051716	0.354	cellular response to stimulus
GO:0031325	0.348	positive regulation of cellular metabolic process
GO:0071704	0.300	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.985	nucleoplasm
GO:0032991	0.947	protein-containing complex
GO:0005829	0.934	cytosol
GO:0140513	0.793	nuclear protein-containing complex
GO:0005667	0.786	transcription regulator complex
GO:0090575	0.711	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]