StarFunc result for job id Q9BYW1

User Input

>input (496 residues)
MRALRRLIQGRILLLTICAAGIGGTFQFGYNLSIINAPTLHIQEFTNETWQARTGEPLPD
HLVLLMWSLIVSLYPLGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGS
FEMIMLGRLLVGVNAGVSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLRE
LLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLA
GELEELEEERAACQGCRARRPWELFQHRALRRQVTSLVVLGSAMELCGNDSVYAYASSVF
RKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCWGSIFTVALC
LQSSFPWTLYLAMACIFAFILSFGIGPAGVTGILATELFDQMARPAACMVCGALMWIMLI
LVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPETKGKTFQEISKELHRLNFPRRA
QGPTWRSLEVIQSTEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BYW1	1.000	1.000	1.538E-63	496	1.000	1.000	Q9BYW1.pdb.gz	GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens OX=9606 GN=SLC2A11 PE=2 SV=1
2	AFDB:Q9WV38	0.927	0.918	4.822E-36	501	0.383	0.379	Q9WV38.pdb.gz	GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus OX=10090 GN=Slc2a5 PE=1 SV=2
3	AFDB:P22732	0.926	0.917	1.416E-35	501	0.405	0.401	P22732.pdb.gz	GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens OX=9606 GN=SLC2A5 PE=1 SV=1
4	AFDB:P43427	0.925	0.914	1.948E-35	502	0.377	0.373	P43427.pdb.gz	GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus OX=10116 GN=Slc2a5 PE=1 SV=1
5	AFDB:Q6PXP3	0.919	0.890	2.790E-35	512	0.403	0.391	Q6PXP3.pdb.gz	GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens OX=9606 GN=SLC2A7 PE=1 SV=2
6	AFDB:Q285P3	0.922	0.937	2.970E-33	488	0.325	0.330	Q285P3.pdb.gz	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
7	AFDB:P11166	0.923	0.930	3.484E-33	492	0.347	0.350	P11166.pdb.gz	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
8	AFDB:P46896	0.918	0.930	3.626E-33	490	0.349	0.353	P46896.pdb.gz	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
9	AFDB:Q3T9X0	0.838	0.777	3.927E-33	538	0.401	0.370	Q3T9X0.pdb.gz	GTR9_MOUSE Solute carrier family 2, facilitated glucose transporter member 9 OS=Mus musculus OX=10090 GN=Slc2a9 PE=1 SV=1
10	AFDB:Q9NRM0	0.836	0.773	1.249E-32	540	0.401	0.369	Q9NRM0.pdb.gz	GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens OX=9606 GN=SLC2A9 PE=1 SV=2
11	PDB:7sptA	0.912	0.962	4.043E-30	470	0.321	0.338	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
12	PDB:4ybqB	0.856	0.917	2.099E-28	462	0.373	0.400	4ybqB.pdb.gz
13	PDB:6thaA	0.797	0.875	4.714E-27	448	0.331	0.366	6thaA.pdb.gz
14	PDB:7wsmA	0.817	0.868	3.465E-26	464	0.347	0.371	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
15	PDB:7aaqA	0.826	0.840	9.880E-18	487	0.212	0.216	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
16	PDB:4gbyA	0.810	0.844	1.489E-16	475	0.208	0.217	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
17	PDB:4ja4A	0.654	0.724	1.848E-11	442	0.194	0.217	4ja4A.pdb.gz
18	PDB:7zh0A	0.642	0.643	5.125E-9	495	0.206	0.206	7zh0A.pdb.gz
19	PDB:6s4mA	0.481	0.547	3.086E-8	426	0.149	0.174	6s4mA.pdb.gz
20	PDB:6oopA	0.551	0.669	4.651E-7	392	0.133	0.168	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BYW1	0.0	990	496	1.000	1.000	GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens OX=9606 GN=SLC2A11 PE=2 SV=1
2	Q3T9X0	7.18e-131	392	538	0.403	0.372	GTR9_MOUSE Solute carrier family 2, facilitated glucose transporter member 9 OS=Mus musculus OX=10090 GN=Slc2a9 PE=1 SV=1
3	Q9NRM0	7.83e-129	387	540	0.393	0.361	GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens OX=9606 GN=SLC2A9 PE=1 SV=2
4	Q9WV38	9.87e-121	365	501	0.383	0.379	GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus OX=10090 GN=Slc2a5 PE=1 SV=2
5	P43427	1.44e-120	364	502	0.383	0.378	GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus OX=10116 GN=Slc2a5 PE=1 SV=1
6	Q6PXP3	9.76e-115	350	512	0.401	0.389	GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens OX=9606 GN=SLC2A7 PE=1 SV=2
7	P22732	2.44e-113	346	501	0.399	0.395	GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens OX=9606 GN=SLC2A5 PE=1 SV=1
8	P27674	2.77e-105	325	492	0.351	0.354	GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus OX=9913 GN=SLC2A1 PE=1 SV=1
9	P17809	1.38e-104	323	492	0.351	0.354	GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus OX=10090 GN=Slc2a1 PE=1 SV=4
10	P11167	2.08e-103	320	492	0.347	0.350	GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus OX=10116 GN=Slc2a1 PE=1 SV=1
11	P46896	1.53e-102	317	490	0.341	0.345	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
12	P11166	4.04e-101	314	492	0.345	0.348	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
13	A0A060VUB5	6.44e-101	313	480	0.351	0.362	A0A060VUB5_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081471001 PE=3 SV=1
14	Q285P3	1.49e-100	312	488	0.323	0.328	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
15	F1R0Q1	4.77e-99	308	489	0.349	0.354	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
16	Q9I8M1	1.23e-98	307	492	0.349	0.352	Q9I8M1_ONCMY Glucose transporter 1A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
17	P11169	2.05e-91	289	496	0.325	0.325	GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens OX=9606 GN=SLC2A3 PE=1 SV=1
18	Q9DFV2	3.14e-90	286	503	0.335	0.330	Q9DFV2_SALTR Muscle glucose transporter OS=Salmo trutta OX=8032 PE=2 SV=1
19	P14672	9.08e-90	285	509	0.357	0.348	GLUT4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens OX=9606 GN=SLC2A4 PE=1 SV=1
20	A0A060WJ53	1.80e-89	283	477	0.331	0.344	A0A060WJ53_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006116001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	8.5e-07	39.8	Major Facilitator Superfamily
2	PF00083 Sugar_tr	8.2e-90	313.5	Sugar (and other) transporter
3	PF12845 TBD	7.2e+02	11.4	TBD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000020689

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000011850	0.657	Solute carrier family 5 (sodium/sugar cotransporter), member 9
2	9593.ENSGGOP00000005847	0.648	Chromosome 9 open reading frame 3
3	9593.ENSGGOP00000002824	0.639	Formimidoyltransferase cyclodeaminase
4	9593.ENSGGOP00000004850	0.628	ADP-ribosylation factor-like 8B
5	9593.ENSGGOP00000004423	0.618	NME/NM23 nucleoside diphosphate kinase 4
6	9593.ENSGGOP00000027712	0.614	Solute carrier family 5 (sodium/glucose cotransporter), member 1
7	9593.ENSGGOP00000009514	0.610	Zinc finger CCCH-type containing 7A
8	9593.ENSGGOP00000010276	0.603	Solute carrier family 22 (organic anion/urate transporter), member 13
9	9593.ENSGGOP00000010082	0.597	Musashi RNA-binding protein 1
10	9593.ENSGGOP00000003433	0.573	Solute carrier family 25 (mitochondrial carrier
11	9593.ENSGGOP00000004372	0.570	Solute carrier family 5 (sodium/glucose cotransporter), member 2
12	9593.ENSGGOP00000012862	0.569	Musashi RNA-binding protein 2
13	9593.ENSGGOP00000000549	0.560	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
14	9593.ENSGGOP00000022534	0.555	Uncharacterized protein
15	9593.ENSGGOP00000018677	0.554	Transporter
16	9593.ENSGGOP00000008319	0.525	Solute carrier family 7 (anionic amino acid transporter), member 13
17	9593.ENSGGOP00000025459	0.525	Uncharacterized protein
18	9593.ENSGGOP00000011322	0.516	Solute carrier family 15 (oligopeptide transporter), member 2
19	9593.ENSGGOP00000009586	0.505	PPARG coactivator 1 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005355	0.999	glucose transmembrane transporter activity
GO:0005353	0.994	fructose transmembrane transporter activity
GO:0005488	0.808	binding
GO:0005515	0.742	protein binding
GO:0022804	0.649	active transmembrane transporter activity
GO:0008514	0.636	organic anion transmembrane transporter activity
GO:0015291	0.633	secondary active transmembrane transporter activity
GO:0015318	0.542	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008645	0.999	hexose transmembrane transport
GO:1904659	0.963	glucose transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.978	membrane-bounded organelle
GO:0043229	0.978	intracellular organelle
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0005634	0.960	nucleus
GO:0005737	0.916	cytoplasm
GO:0031982	0.867	vesicle
GO:0070013	0.760	intracellular organelle lumen
GO:0031981	0.717	nuclear lumen
GO:0005654	0.659	nucleoplasm
GO:0012505	0.399	endomembrane system
GO:0016324	0.300	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]