StarFunc result for job id Q9BYW2

User Input

>input (2564 residues)
MKQLQPQPPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPMFKGVASSRFLPKGTK
TKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQSDTPNPPAVPLQVDSTPKMKMEI
GDTLSTAEESSPPKSRVELGKIHFKKHLLHVTSRPLLATTTAVASPPTHAAPLPAVIAES
TTVDSPPSSPPPPPPPAQATTLSSPAPVTEPVALPHTPITVLMAAPVPLPVDVAVRSLKE
PPIIIVPESLEADTKQDTISNSLEEHVTQILNEQADISSKKEDSHIGKDEEIPDSSKISL
SCKKTGSKKKSSQSEGIFLGSESDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKS
EDLGKPSRSKTDRDDKYFSYSKLERDTRYVSSRCRSERERRRSRSHSRSERGSRTNLSYS
RSERSHYYDSDRRYHRSSPYRERTRYSRPYTDNRARESSDSEEEYKKTYSRRTSSHSSSY
RDLRTSSYSKSDRDCKTETSYLEMERRGKYSSKLERESKRTSENEAIKRCCSPPNELGFR
RGSSYSKHDSSASRYKSTLSKPIPKSDKFKNSFCCTELNEEIKQSHSFSLQTPCSKGSEL
RMINKNPEREKAGSPAPSNRLNDSPTLKKLDELPIFKSEFITHDSHDSIKELDSLSKVKN
DQLRSFCPIELNINGSPGAESDLATFCTSKTDAVLMTSDDSVTGSELSPLVKACMLSSNG
FQNISRCKEKDLDDTCMLHKKSESPFRETEPLVSPHQDKLMSMPVMTVDYSKTVVKEPVD
TRVSCCKTKDSDIYCTLNDSNPSLCNSEAENIEPSVMKISSNSFMNVHLESKPVICDSRN
LTDHSKFACEEYKQSIGSTSSASVNHFDDLYQPIGSSGIASSLQSLPPGIKVDSLTLLKC
GENTSPVLDAVLKSKKSSEFLKHAGKETIVEVGSDLPDSGKGFASRENRRNNGLSGKCLQ
EAQEEGNSILPERRGRPEISLDERGEGGHVHTSDDSEVVFSSCDLNLTMEDSDGVTYALK
CDSSGHAPEIVSTVHEDYSGSSESSNDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPM
EETSPCSSRSSQSYRHYSDHWEDERLESRRHLYEEKFESIASKACPQTDKFFLHKGTEKN
PEISFTQSSRKQIDNRLPELSHPQSDGVDSTSHTDVKSDPLGHPNSEETVKAKIPSRQQE
ELPIYSSDFEDVPNKSWQQTTFQNRPDSRLGKTELSFSSSCEIPHVDGLHSSEELRNLGW
DFSQEKPSTTYQQPDSSYGACGGHKYQQNAEQYGGTRDYWQGNGYWDPRSGRPPGTGVVY
DRTQGQVPDSLTDDREEEENWDQQDGSHFSDQSDKFLLSLQKDKGSVQAPEISSNSIKDT
LAVNEKKDFSKNLEKNDIKDRGPLKKRRQEIESDSESDGELQDRKKVRVEVEQGETSVPP
GSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCE
CTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKK
GWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQK
GNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFC
GSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSR
LMVRIETLEQKLTCLELIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEI
IKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPPLSEGDGYSSENTSRAHTPLNTPDP
STKLSTEADTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPVEEE
EELQSQQLLPQQLPECKVDSETNIEASKLPTSEPEADAEIEPKESNGTKLEEPINEETPS
QDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENTTTER
GRDAVGFRDQTPAPKTPNRSRERDPDKQTQNKEKRKRRSSLSPPSSAYERGTKRPDDRYD
TPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAP
HHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAP
PPVPVVPHVAAPVEVSSSQYVAQSDGVVHQDSSVAVLPVPAPGPVQGQNYSVWDSNQQSV
SVQQQYSPAQSQATIYYQGQTCPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAH
PQGVVVQPAAAVTTIVAPGQPQPLQPSEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARD
PEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKASKKPKTAEA
DTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKE
LKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q5F9	0.335	0.337	0.000	2537	0.849	0.858	E9Q5F9.pdb.gz	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
2	AFDB:Q9BYW2	1.000	1.000	0.000	2564	1.000	1.000	Q9BYW2.pdb.gz	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
3	AFDB:Q9VYD1	0.148	0.163	4.085E-42	2313	0.187	0.207	Q9VYD1.pdb.gz	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2
4	AFDB:Q2LAE1	0.091	0.130	2.727E-34	1759	0.124	0.180	Q2LAE1.pdb.gz	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
5	AFDB:Q96L73	0.081	0.077	9.779E-30	2696	0.173	0.164	Q96L73.pdb.gz	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
6	AFDB:O88491	0.088	0.088	1.865E-29	2588	0.161	0.159	O88491.pdb.gz	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
7	AFDB:Q9VW15	0.086	0.099	4.481E-22	2226	0.131	0.150	Q9VW15.pdb.gz	ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster OX=7227 GN=ash1 PE=1 SV=3
8	AFDB:Q8IE95	0.079	0.079	3.636E-16	2548	0.126	0.126	Q8IE95.pdb.gz	SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=SETVS PE=2 SV=1
9	PDB:7td5A	0.066	0.307	2.005E-14	497	0.025	0.129	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
10	PDB:5wg6A	0.058	0.278	6.545E-14	517	0.029	0.145	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
11	PDB:5hynA	0.063	0.261	1.467E-13	581	0.023	0.102	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
12	PDB:6wkrC	0.060	0.247	2.025E-13	606	0.022	0.092	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
13	AFDB:Q18221	0.064	0.104	2.714E-13	1507	0.080	0.137	Q18221.pdb.gz	SET2_CAEEL Histone-lysine N-methyltransferase set-2 OS=Caenorhabditis elegans OX=6239 GN=set-2 PE=1 SV=2
14	PDB:7td5F	0.062	0.333	4.300E-13	447	0.023	0.130	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
15	PDB:7ksoA	0.059	0.365	8.198E-13	395	0.022	0.142	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
16	AFDB:E9PYH6	0.060	0.086	1.159E-12	1716	0.091	0.136	E9PYH6.pdb.gz	SET1A_MOUSE Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1
17	PDB:1pegA	0.057	0.504	1.776E-10	266	0.026	0.248	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
18	PDB:5h6zA	0.040	0.700	3.756E-5	123	0.009	0.179	5h6zA.pdb.gz
19	PDB:2g46A	0.039	0.645	5.528E-4	119	0.010	0.218	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
20	PDB:5ex0A	0.061	0.246	2.775E-3	429	0.022	0.131	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KB10	0.0	4113	2523	0.849	0.863	A0A0G2KB10_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
2	A0A8I5ZLS2	0.0	3949	2419	0.817	0.866	A0A8I5ZLS2_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
3	A0A8I6A5I9	0.0	4108	2526	0.848	0.861	A0A8I6A5I9_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
4	A0A8I6A709	0.0	4113	2520	0.849	0.864	A0A8I6A709_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
5	A0A8I6AUV5	0.0	3890	2426	0.814	0.860	A0A8I6AUV5_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
6	D4A5H6	0.0	3829	2294	0.781	0.873	D4A5H6_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=2
7	E9Q5F9	0.0	4032	2537	0.850	0.859	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
8	Q9BYW2	0.0	5294	2564	1.000	1.000	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
9	Q9VYD1	4.98e-73	275	2313	0.045	0.050	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2
10	Q2LAE1	6.22e-62	238	1759	0.041	0.060	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
11	Q55FF7	3.15e-57	218	898	0.037	0.105	Q55FF7_DICDI SET domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268132 PE=4 SV=1
12	O14026	3.48e-56	214	798	0.049	0.157	SET2_SCHPO Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set2 PE=1 SV=1
13	P46995	1.37e-52	202	733	0.038	0.132	SET2_YEAST Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SET2 PE=1 SV=2
14	Q84WW6	5.27e-51	191	492	0.035	0.181	ASHH1_ARATH Histone-lysine N-methyltransferase ASHH1 OS=Arabidopsis thaliana OX=3702 GN=ASHH1 PE=1 SV=1
15	Q8BVE8	7.56e-51	201	1365	0.036	0.068	NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus OX=10090 GN=Nsd2 PE=1 SV=2
16	O96028	2.41e-50	200	1365	0.036	0.067	NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
17	Q9BZ95	3.48e-49	196	1437	0.039	0.069	NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3 PE=1 SV=1
18	O88491	1.41e-48	195	2588	0.037	0.037	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
19	Q6P2L6	2.09e-48	193	1439	0.043	0.076	NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus OX=10090 GN=Nsd3 PE=1 SV=2
20	Q96L73	6.77e-48	192	2696	0.037	0.035	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17907 AWS	4.4e-09	47.5	AWS domain
2	PF08711 Med26	35	15.9	TFIIS helical bundle-like domain
3	PF00856 SET	9.3e-15	66.9	SET domain
4	PF08236 SRI	2.8e-23	93.2	SRI (Set2 Rpb1 interacting) domain
5	PF00397 WW	1.3e-07	42.8	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480158	0.999	DNA-directed RNA polymerase II subunit RPB1
2	9606.ENSP00000347184	0.994	Huntingtin
3	9606.ENSP00000351446	0.986	WD repeat-containing protein 5
4	9606.ENSP00000244537	0.984	Histone cluster 1 H4 family member f
5	9606.ENSP00000295321	0.984	Protein IWS1 homolog
6	9606.ENSP00000307208	0.970	Nucleosome-remodeling factor subunit BPTF
7	9606.ENSP00000319104	0.966	Transcription elongation factor SPT6
8	9606.ENSP00000386458	0.938	Pre-mRNA-processing factor 40 homolog A
9	9606.ENSP00000470252	0.937	Transcription elongation factor SPT5
10	9606.ENSP00000282516	0.935	Nipped-B-like protein
11	9606.ENSP00000331310	0.918	Mortality factor 4-like protein 1
12	9606.ENSP00000378307	0.917	Protein polybromo-1
13	9606.ENSP00000370625	0.914	DNA-directed RNA polymerase II subunit RPB2
14	9606.ENSP00000369666	0.910	F-box/LRR-repeat protein 19
15	9606.ENSP00000381657	0.909	Histone-lysine N-methyltransferase, H3 lysine-79 specific
16	9606.ENSP00000219252	0.906	DNA-directed RNA polymerase II subunit RPB3
17	9606.ENSP00000373772	0.897	E3 ubiquitin-protein ligase BRE1A
18	9606.ENSP00000380692	0.893	Lysine-specific demethylase 7A
19	9606.ENSP00000376204	0.892	Histone-lysine N-methyltransferase ASH1L
20	9606.ENSP00000364550	0.887	Lysine-specific demethylase 5C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043014	1.000	alpha-tubulin binding
GO:0046975	1.000	histone H3K36 methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.990	positive regulation of biological process
GO:0050896	0.940	response to stimulus
GO:0051240	0.933	positive regulation of multicellular organismal process
GO:0009987	0.849	cellular process
GO:0050794	0.843	regulation of cellular process
GO:0019222	0.776	regulation of metabolic process
GO:0060255	0.764	regulation of macromolecule metabolic process
GO:0044238	0.750	primary metabolic process
GO:0043170	0.740	macromolecule metabolic process
GO:0006807	0.721	nitrogen compound metabolic process
GO:0044237	0.691	cellular metabolic process
GO:0080090	0.676	regulation of primary metabolic process
GO:0051171	0.676	regulation of nitrogen compound metabolic process
GO:0010468	0.656	regulation of gene expression
GO:1901564	0.594	organonitrogen compound metabolic process
GO:0043412	0.593	macromolecule modification
GO:0031323	0.589	regulation of cellular metabolic process
GO:0019538	0.579	protein metabolic process
GO:0019219	0.548	regulation of nucleobase-containing compound metabolic process
GO:0036211	0.537	protein modification process
GO:0045778	0.530	positive regulation of ossification
GO:0010038	0.499	response to metal ion
GO:0014070	0.463	response to organic cyclic compound
GO:0043279	0.449	response to alkaloid
GO:0010604	0.385	positive regulation of macromolecule metabolic process
GO:0009889	0.375	regulation of biosynthetic process
GO:0071840	0.346	cellular component organization or biogenesis
GO:0016043	0.342	cellular component organization
GO:0048522	0.337	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043228	0.967	non-membrane-bounded organelle
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0005694	0.805	chromosome
GO:0032991	0.736	protein-containing complex
GO:0005737	0.689	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]