StarFunc result for job id Q9BYX4

User Input

>input (1025 residues)
MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVE
LLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNL
LQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSA
FLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGM
ENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARA
SPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVI
VLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS
LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIP
LPQILGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFA
IADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVC
AEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDE
DDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESAR
GIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRT
GKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV
IEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNP
SLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEI
ICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCL
FSDED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7LCX1	0.865	0.866	0.000	1023	0.849	0.850	A7LCX1.pdb.gz	A7LCX1_PIG RNA helicase OS=Sus scrofa OX=9823 GN=MDA5 PE=1 SV=1
2	AFDB:Q8R5F7	0.848	0.848	0.000	1025	0.796	0.796	Q8R5F7.pdb.gz	IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ifih1 PE=1 SV=1
3	AFDB:Q9BYX4	1.000	1.000	0.000	1025	1.000	1.000	Q9BYX4.pdb.gz	IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IFIH1 PE=1 SV=3
4	AFDB:A0A0E3D804	0.766	0.786	7.972E-101	997	0.474	0.487	A0A0E3D804.pdb.gz	A0A0E3D804_DANRE RNA helicase OS=Danio rerio OX=7955 GN=MDA5a PE=2 SV=1
5	AFDB:D7F7W8	0.798	0.815	2.088E-97	1002	0.476	0.487	D7F7W8.pdb.gz	D7F7W8_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=mda5 PE=2 SV=1
6	AFDB:A0A060VZM9	0.779	0.779	7.111E-97	1026	0.476	0.476	A0A060VZM9.pdb.gz	A0A060VZM9_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00074546001 PE=3 SV=1
7	PDB:7bkpA	0.657	0.971	4.580E-90	689	0.582	0.866	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
8	PDB:6h61A	0.630	0.971	8.982E-81	660	0.558	0.867	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
9	AFDB:Q96C10	0.606	0.902	7.717E-64	678	0.282	0.426	Q96C10.pdb.gz	DHX58_HUMAN ATP-dependent RNA helicase DHX58 OS=Homo sapiens OX=9606 GN=DHX58 PE=1 SV=1
10	AFDB:Q6Q899	0.618	0.681	1.513E-61	926	0.289	0.320	Q6Q899.pdb.gz	RIGI_MOUSE Antiviral innate immune response receptor RIG-I OS=Mus musculus OX=10090 GN=Rigi PE=1 SV=2
11	AFDB:Q99J87	0.603	0.896	7.167E-61	678	0.288	0.435	Q99J87.pdb.gz	DHX58_MOUSE ATP-dependent RNA helicase DHX58 OS=Mus musculus OX=10090 GN=Dhx58 PE=1 SV=2
12	AFDB:O95786	0.598	0.659	3.394E-60	925	0.294	0.325	O95786.pdb.gz	RIGI_HUMAN Antiviral innate immune response receptor RIG-I OS=Homo sapiens OX=9606 GN=RIGI PE=1 SV=2
13	PDB:8dvsA	0.573	0.845	1.123E-47	682	0.239	0.359	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
14	PDB:7tnxA	0.540	0.831	3.063E-38	647	0.230	0.365	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
15	PDB:4a2wA	0.395	0.547	5.428E-37	678	0.215	0.324	4a2wA.pdb.gz
16	PDB:7yymA	0.296	0.247	2.884E-19	1281	0.130	0.104	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
17	PDB:7w0dA	0.387	0.266	3.345E-18	1544	0.102	0.068	7w0dA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
18	PDB:7v6bA	0.293	0.216	9.889E-18	1496	0.099	0.068	7v6bA.pdb.gz
19	PDB:7v6cA	0.290	0.207	1.375E-17	1540	0.098	0.065	7v6cA.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
20	PDB:7eldA	0.371	0.338	1.511E-17	1137	0.130	0.117	7eldA.pdb.gz	Structural basis of microRNA processing by Dicer-like 1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060VZM9	0.0	867	1026	0.488	0.487	A0A060VZM9_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00074546001 PE=3 SV=1
2	A0A0E3D804	0.0	897	997	0.484	0.497	A0A0E3D804_DANRE RNA helicase OS=Danio rerio OX=7955 GN=MDA5a PE=2 SV=1
3	A7LCX1	0.0	1727	1023	0.849	0.850	A7LCX1_PIG RNA helicase OS=Sus scrofa OX=9823 GN=MDA5 PE=1 SV=1
4	D7F7W8	0.0	879	1002	0.485	0.496	D7F7W8_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=mda5 PE=2 SV=1
5	Q8R5F7	0.0	1683	1025	0.798	0.798	IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ifih1 PE=1 SV=1
6	Q9BYX4	0.0	2135	1025	1.000	1.000	IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IFIH1 PE=1 SV=3
7	A0A060Y3B2	4.03e-178	536	678	0.297	0.448	A0A060Y3B2_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00027343001 PE=3 SV=1
8	D7F7W9	1.40e-177	535	677	0.297	0.449	D7F7W9_ONCMY RNA helicase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=dhx58 PE=2 SV=1
9	Q99J87	8.96e-175	528	678	0.290	0.438	DHX58_MOUSE ATP-dependent RNA helicase DHX58 OS=Mus musculus OX=10090 GN=Dhx58 PE=1 SV=2
10	Q96C10	2.33e-171	519	678	0.286	0.432	DHX58_HUMAN ATP-dependent RNA helicase DHX58 OS=Homo sapiens OX=9606 GN=DHX58 PE=1 SV=1
11	D7F7X0	3.38e-168	509	623	0.280	0.461	D7F7X0_ONCMY RNA helicase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=dhx58 PE=2 SV=1
12	O95786	7.65e-114	375	925	0.310	0.344	RIGI_HUMAN Antiviral innate immune response receptor RIG-I OS=Homo sapiens OX=9606 GN=RIGI PE=1 SV=2
13	D3TI84	4.32e-106	355	933	0.258	0.283	D3TI84_ANAPL RNA helicase OS=Anas platyrhynchos OX=8839 GN=RIG-I PE=1 SV=1
14	Q6Q899	7.23e-104	348	926	0.298	0.329	RIGI_MOUSE Antiviral innate immune response receptor RIG-I OS=Mus musculus OX=10090 GN=Rigi PE=1 SV=2
15	C7C1L7	2.93e-99	337	962	0.244	0.260	C7C1L7_SALSA RNA helicase OS=Salmo salar OX=8030 GN=rig-I PE=2 SV=1
16	A0A0D5W690	2.14e-98	334	937	0.299	0.327	A0A0D5W690_DANRE RNA helicase OS=Danio rerio OX=7955 GN=rigi PE=2 SV=1
17	Q93413	1.32e-46	184	1119	0.185	0.170	Q93413_CAEEL Helicase ATP-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=drh-3 PE=1 SV=3
18	G5EDI8	3.08e-31	135	1037	0.097	0.095	G5EDI8_CAEEL Dicer-related helicase OS=Caenorhabditis elegans OX=6239 GN=drh-1 PE=1 SV=1
19	Q8TZH8	1.42e-24	112	764	0.142	0.191	Q8TZH8_PYRFU ATP-dependent RNA helicase, putative OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF2015 PE=1 SV=1
20	Q09884	1.58e-19	97.4	1374	0.060	0.044	DCR1_SCHPO Protein Dicer OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dcr1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	2.2e+02	13.5	AAA domain
2	PF13401 AAA_22	23	16.7	AAA domain
3	PF00619 CARD	1.6e-11	55.3	Caspase recruitment domain
4	PF16739 CARD_2	7.3e-43	155.8	Caspase recruitment domain
5	PF00270 DEAD	5.9e-15	67.0	DEAD/DEAH box helicase
6	PF12340 DUF3638	53	14.6	Protein of unknown function (DUF3638)
7	PF00271 Helicase_C	1.8e-17	75.1	Helicase conserved C-terminal domain
8	PF04851 ResIII	2.1e-17	75.2	Type III restriction enzyme, res subunit
9	PF18119 RIG-I_C	3.5e-24	96.8	RIG-I receptor C-terminal domain
10	PF11648 RIG-I_C-RD	1.6e-32	123.5	C-terminal domain of RIG-I
11	PF18766 SWI2_SNF2	0.048	24.9	SWI2/SNF2 ATPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263642

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401980	0.999	Mitochondrial antiviral-signaling protein
2	9606.ENSP00000380697	0.969	Interferon regulatory factor 7
3	9606.ENSP00000217740	0.968	E3 ubiquitin-protein ligase RNF125
4	9606.ENSP00000360869	0.959	Interferon-induced protein with tetratricopeptide repeats 1
5	9606.ENSP00000387334	0.959	NLR family member X1
6	9606.ENSP00000287156	0.954	Ubiquitin/ISG15-conjugating enzyme E2 L6
7	9606.ENSP00000371471	0.953	Radical S-adenosyl methionine domain-containing protein 2
8	9606.ENSP00000471896	0.952	Interferon regulatory factor 3
9	9606.ENSP00000381601	0.950	Interferon-induced GTP-binding protein Mx1
10	9606.ENSP00000262510	0.949	Protein NLRC5
11	9606.ENSP00000329967	0.948	Serine/threonine-protein kinase TBK1
12	9606.ENSP00000296795	0.947	Toll-like receptor 3
13	9606.ENSP00000368699	0.943	Ubiquitin-like protein ISG15
14	9606.ENSP00000323889	0.940	E3 ubiquitin/ISG15 ligase TRIM25
15	9606.ENSP00000156084	0.938	OTU domain-containing protein 5
16	9606.ENSP00000360891	0.936	Interferon-induced protein with tetratricopeptide repeats 2
17	9606.ENSP00000377344	0.935	Probable ATP-dependent RNA helicase DDX60
18	9606.ENSP00000363019	0.932	Ubiquitin-conjugating enzyme E2 D1
19	9606.ENSP00000369213	0.930	Probable ATP-dependent RNA helicase DDX58
20	9606.ENSP00000381717	0.930	Ubiquitin-conjugating enzyme E2 D2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0097159	0.964	organic cyclic compound binding
GO:1901363	0.963	heterocyclic compound binding
GO:0003824	0.954	catalytic activity
GO:0003676	0.943	nucleic acid binding
GO:0003723	0.888	RNA binding
GO:0003725	0.765	double-stranded RNA binding
GO:0042802	0.653	identical protein binding
GO:0140640	0.589	catalytic activity, acting on a nucleic acid
GO:0140657	0.544	ATP-dependent activity
GO:0016787	0.527	hydrolase activity
GO:0046872	0.497	metal ion binding
GO:0004386	0.475	helicase activity
GO:0008270	0.471	zinc ion binding
GO:0008186	0.462	ATP-dependent activity, acting on RNA
GO:0016887	0.458	ATP hydrolysis activity
GO:0003724	0.444	RNA helicase activity
GO:0003727	0.441	single-stranded RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0050789	0.979	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0098542	0.968	defense response to other organism
GO:0009615	0.955	response to virus
GO:0010468	0.950	regulation of gene expression
GO:0009987	0.945	cellular process
GO:0043331	0.940	response to dsRNA
GO:0002376	0.937	immune system process
GO:0071704	0.935	organic substance metabolic process
GO:0043330	0.924	response to exogenous dsRNA
GO:0051716	0.923	cellular response to stimulus
GO:0048583	0.920	regulation of response to stimulus
GO:0006955	0.886	immune response
GO:0045087	0.874	innate immune response
GO:0031349	0.869	positive regulation of defense response
GO:0045088	0.868	regulation of innate immune response
GO:0050778	0.861	positive regulation of immune response
GO:0001819	0.848	positive regulation of cytokine production
GO:0051607	0.841	defense response to virus
GO:0045089	0.840	positive regulation of innate immune response
GO:0032479	0.835	regulation of type I interferon production
GO:0048519	0.830	negative regulation of biological process
GO:0002253	0.828	activation of immune response
GO:0007154	0.810	cell communication
GO:0044238	0.803	primary metabolic process
GO:0043170	0.795	macromolecule metabolic process
GO:0002757	0.775	immune response-activating signaling pathway
GO:0002758	0.755	innate immune response-activating signaling pathway
GO:0002221	0.749	pattern recognition receptor signaling pathway
GO:0032481	0.728	positive regulation of type I interferon production
GO:0032728	0.711	positive regulation of interferon-beta production
GO:0030522	0.709	intracellular receptor signaling pathway
GO:0002753	0.701	cytosolic pattern recognition receptor signaling pathway
GO:0006807	0.594	nitrogen compound metabolic process
GO:0080090	0.533	regulation of primary metabolic process
GO:0051171	0.533	regulation of nitrogen compound metabolic process
GO:0031323	0.468	regulation of cellular metabolic process
GO:0019219	0.432	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.417	regulation of macromolecule biosynthetic process
GO:0031326	0.403	regulation of cellular biosynthetic process
GO:0050792	0.362	regulation of viral process
GO:0051252	0.357	regulation of RNA metabolic process
GO:0048522	0.338	positive regulation of cellular process
GO:2001141	0.332	regulation of RNA biosynthetic process
GO:0060759	0.325	regulation of response to cytokine stimulus
GO:1901564	0.316	organonitrogen compound metabolic process
GO:1903900	0.308	regulation of viral life cycle
GO:0070887	0.306	cellular response to chemical stimulus
GO:0006355	0.306	regulation of DNA-templated transcription
GO:0048525	0.305	negative regulation of viral process
GO:0019538	0.303	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005739	0.835	mitochondrion
GO:0005634	0.711	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.527	Hydrolases.
RHEA:13065	0.458	ATP + H2O = ADP + H(+) + phosphate
EC:3.6.4.13	0.444	RNA helicase.

[back to server]