StarFunc result for job id Q9BZ29

User Input

>input (2069 residues)
MSQPPLLPASAETRKFTRALSKPGTAAELRQSVSEVVRGSVLLAKPKLIEPLDYENVIVQ
KKTQILNDCLREMLLFPYDDFQTAILRRQGRYICSTVPAKAEEEAQSLFVTECIKTYNSD
WHLVNYKYEDYSGEFRQLPNKVVKLDKLPVHVYEVDEEVDKDEDAASLGSQKGGITKHGW
LYKGNMNSAISVTMRSFKRRFFHLIQLGDGSYNLNFYKDEKISKEPKGSIFLDSCMGVVQ
NNKVRRFAFELKMQDKSSYLLAADSEVEMEEWITILNKILQLNFEAAMQEKRNGDSHEDD
EQSKLEGSGSGLDSYLPELAKSAREAEIKLKSESRVKLFYLDPDAQKLDFSSAEPEVKSF
EEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNVEPFFVTLSLFDIKYNRKISADFHVDL
NHFSVRQMLATTSPALMNGSGQSPSVLKGILHEAAMQYPKQGIFSVTCPHPDIFLVARIE
KVLQGSITHCAEPYMKSSDSSKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNL
DKNARFSAIYRQDSNKLSNDDMLKLLADFRKPEKMAKLPVILGNLDITIDNVSSDFPNYV
NSSYIPTKQFETCSKTPITFEVEEFVPCIPKHTQPYTIYTNHLYVYPKYLKYDSQKSFAK
ARNIAICIEFKDSDEEDSQPLKCIYGRPGGPVFTRSAFAAVLHHHQNPEFYDEIKIELPT
QLHEKHHLLLTFFHVSCDNSSKGSTKKRDVVETQVGYSWLPLLKDGRVVTSEQHIPVSAN
LPSGYLGYQELGMGRHYGPEIKWVDGGKPLLKISTHLVSTVYTQDQHLHNFFQYCQKTES
GAQALGNELVKYLKSLHAMEGHVMIAFLPTILNQLFRVLTRATQEEVAVNVTRVIIHVVA
QCHEEGLESHLRSYVKYAYKAEPYVASEYKTVHEELTKSMTTILKPSADFLTSNKLLKYS
WFFFDVLIKSMAQHLIENSKVKLLRNQRFPASYHHAVETVVNMLMPHITQKFRDNPEASK
NANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAPGDPKTLFEYKFEFLRVVCNHEHYIP
LNLPMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEFREVRLIAISVL
KNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNAGMTVKDES
LALPAVNPLVTPQKGSTLDNSLHKDLLGAISGIASPYTTSTPNINSVRNADSRGSLISTD
SGNSLPERNSEKSNSLDKHQQSSTLGNSVVRCDKLDQSEIKSLLMCFLYILKSMSDDALF
TYWNKASTSELMDFFTISEVCLHQFQYMGKRYIARTGMMHARLQQLGSLDNSLTFNHSYG
HSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFL
QKHQSETALKNVFTALRSLIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTEASQL
LYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCANSDRLI
KHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDS
MARIHVKNGDLSEAAMCYVHVTALVAEYLTRKEAVQWEPPLLPHSHSACLRRSRGGVFRQ
GCTAFRVITPNIDEEASMMEDVGMQDVHFNEDVLMELLEQCADGLWKAERYELIADIYKL
IIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQAAQYQFTDSE
TDVEGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLD
SKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRT
ILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKL
QGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALAVNERLIKE
DQLEYQEEMKANYREMAKELSEIMHEQLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AF47	0.796	0.794	0.000	2073	0.595	0.594	A2AF47.pdb.gz	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
2	AFDB:Q8BZN6	0.825	0.796	0.000	2150	0.548	0.527	Q8BZN6.pdb.gz	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
3	AFDB:Q8C147	0.505	0.498	0.000	2100	0.296	0.291	Q8C147.pdb.gz	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
4	AFDB:Q96HP0	0.565	0.570	0.000	2047	0.303	0.306	Q96HP0.pdb.gz	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
5	AFDB:Q96N67	0.531	0.515	0.000	2140	0.302	0.292	Q96N67.pdb.gz	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
6	AFDB:Q9BZ29	1.000	1.000	0.000	2069	1.000	1.000	Q9BZ29.pdb.gz	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
7	AFDB:Q9VPI9	0.454	0.455	0.000	2064	0.292	0.293	Q9VPI9.pdb.gz	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
8	AFDB:Q86I66	0.540	0.496	1.285E-90	2284	0.246	0.223	Q86I66.pdb.gz	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
9	AFDB:Q54CA8	0.568	0.549	1.467E-77	2147	0.228	0.220	Q54CA8.pdb.gz	Q54CA8_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizB PE=3 SV=1
10	AFDB:P59764	0.341	0.354	3.895E-46	1978	0.133	0.140	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
11	PDB:6tgbA	0.235	0.306	6.111E-21	1450	0.082	0.117	6tgbA.pdb.gz
12	PDB:7mopA	0.125	0.111	2.363E-5	2445	0.068	0.057	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
13	PDB:6uqkA	0.099	0.099	3.022E-5	2054	0.080	0.081	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.
14	PDB:3opbA	0.094	0.198	3.710E-5	747	0.045	0.124	3opbA.pdb.gz
15	PDB:6xu2A	0.099	0.153	4.196E-5	1091	0.044	0.083	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
16	PDB:7jq9A	0.103	0.093	9.530E-5	2427	0.065	0.056	7jq9A.pdb.gz
17	PDB:6kxkD	0.050	0.156	1.123E-4	553	0.024	0.090	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
18	PDB:7r5jB0	0.093	0.103	1.914E-4	1748	0.050	0.059	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:3gb8A	0.090	0.151	2.255E-4	958	0.044	0.096	3gb8A.pdb.gz
20	PDB:5itdA	0.061	0.117	2.768E-4	995	0.021	0.043	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YD85	0.0	2202	2199	0.544	0.512	A0A2R8YD85_HUMAN Dedicator of cytokinesis 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=1
2	A2AF47	0.0	2509	2073	0.601	0.600	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
3	M9PCG3	0.0	1487	2298	0.416	0.374	M9PCG3_DROME Zizimin, isoform K OS=Drosophila melanogaster OX=7227 GN=Ziz PE=1 SV=1
4	Q5JSL3	0.0	2508	2073	0.602	0.601	DOC11_HUMAN Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2
5	Q8BIK4	0.0	4017	2055	0.927	0.933	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
6	Q8BZN6	0.0	2215	2187	0.551	0.522	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
7	Q96BY6	0.0	2220	2186	0.552	0.522	DOC10_HUMAN Dedicator of cytokinesis protein 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=3
8	Q96HP0	0.0	791	2047	0.291	0.294	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
9	Q9BZ29	0.0	4328	2069	1.000	1.000	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
10	Q9VPI9	0.0	775	2064	0.284	0.285	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
11	Q8R1A4	1.36e-167	569	2130	0.183	0.177	DOCK7_MOUSE Dedicator of cytokinesis protein 7 OS=Mus musculus OX=10090 GN=Dock7 PE=1 SV=3
12	Q96N67	8.64e-167	567	2140	0.182	0.176	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
13	Q8NF50	2.44e-162	553	2099	0.189	0.187	DOCK8_HUMAN Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8 PE=1 SV=3
14	K7ESB7	3.96e-159	544	2082	0.187	0.186	K7ESB7_HUMAN Dedicator of cytokinesis 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=2
15	Q8C147	6.90e-159	543	2100	0.185	0.182	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
16	Q86I66	1.78e-96	351	2284	0.108	0.098	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
17	Q54CA8	4.70e-78	291	2147	0.102	0.098	Q54CA8_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizB PE=3 SV=1
18	Q8SAB7	4.83e-50	199	1830	0.088	0.100	SPK1_ARATH Guanine nucleotide exchange factor SPIKE 1 OS=Arabidopsis thaliana OX=3702 GN=SPK1 PE=1 SV=1
19	Q8IZD9	6.66e-15	84.0	2030	0.039	0.040	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
20	Q8CIQ7	1.14e-14	83.2	2027	0.039	0.040	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	7.4e-46	167.8	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	1.8e-25	100.2	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	4.7e-32	121.3	DHR-2, Lobe C
4	PF14429 DOCK-C2	3.6e-46	168.9	C2 domain in Dock180 and Zizimin proteins
5	PF11878 DOCK_C-D_N	3e-36	135.7	Dedicator of cytokinesis C/D, N terminal
6	PF00169 PH	1.2e-09	49.9	PH domain
7	PF15410 PH_9	6	18.5	Pleckstrin homology domain
8	PF08167 RIX1	3.9e+02	12.1	rRNA processing/ribosome biogenesis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000006229

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000002031	0.971	Cell division cycle 42
2	9601.ENSPPYP00000005759	0.715	Ras homolog family member F (in filopodia)
3	9601.ENSPPYP00000013154	0.668	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
4	9601.ENSPPYP00000003479	0.654	Ras homolog family member D
5	9601.ENSPPYP00000009394	0.648	Uncharacterized protein
6	9601.ENSPPYP00000019439	0.632	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
7	9601.ENSPPYP00000006693	0.625	Ras homolog family member J
8	9601.ENSPPYP00000009837	0.603	Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
9	9601.ENSPPYP00000005819	0.588	DEAH-box helicase 37
10	9601.ENSPPYP00000008754	0.570	CRK proto-oncogene, adaptor protein
11	9601.ENSPPYP00000024295	0.570	CRK like proto-oncogene, adaptor protein
12	9601.ENSPPYP00000013889	0.548	Ras homolog family member Q
13	9601.ENSPPYP00000004149	0.533	Ras homolog family member G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.995	guanyl-nucleotide exchange factor activity
GO:0019899	0.966	enzyme binding
GO:0051020	0.932	GTPase binding
GO:0050839	0.710	cell adhesion molecule binding
GO:0031267	0.685	small GTPase binding
GO:0045296	0.673	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.935	regulation of cellular process
GO:0044093	0.932	positive regulation of molecular function
GO:0051345	0.907	positive regulation of hydrolase activity
GO:0009987	0.886	cellular process
GO:0043087	0.870	regulation of GTPase activity
GO:0043547	0.856	positive regulation of GTPase activity
GO:0050896	0.618	response to stimulus
GO:0048518	0.503	positive regulation of biological process
GO:0048522	0.450	positive regulation of cellular process
GO:0019222	0.375	regulation of metabolic process
GO:0071840	0.340	cellular component organization or biogenesis
GO:0048583	0.337	regulation of response to stimulus
GO:0023051	0.329	regulation of signaling
GO:0010646	0.325	regulation of cell communication
GO:0016043	0.321	cellular component organization
GO:0009966	0.321	regulation of signal transduction
GO:0032501	0.304	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.970	membrane
GO:0043226	0.958	organelle
GO:0043229	0.944	intracellular organelle
GO:0043227	0.934	membrane-bounded organelle
GO:0043231	0.874	intracellular membrane-bounded organelle
GO:0005634	0.766	nucleus
GO:0031974	0.641	membrane-enclosed lumen
GO:0070013	0.631	intracellular organelle lumen
GO:0071944	0.465	cell periphery
GO:0031981	0.465	nuclear lumen
GO:0005886	0.460	plasma membrane
GO:0005654	0.386	nucleoplasm
GO:0012505	0.321	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]