StarFunc result for job id Q9BZ71

User Input

>input (974 residues)
MAKAGRAGGPPPGGGAPWHLRNVLSDSVESSDDEFFDAREEMAEGKNAILIGMSQWNSND
LVEQIETMGKLDEHQGEGTAPCTSSILQEKQRELYRVSLRRQRFPAQGSIEIHEDSEEGC
PQRSCKTHVLLLVLHGGNILDTGAGDPSCKAADIHTFSSVLEKVTRAHFPAALGHILIKF
VPCPAICSEAFSLVSHLNPYSHDEGCLSSSQDHVPLAALPLLAISSPQYQDAVATVIERA
NQVYREFLKSSDGIGFSGQVCLIGDCVGGLLAFDAICYSAGPSGDSPASSSRKGSISSTQ
DTPVAVEEDCSLASSKRLSKSNIDISSGLEDEEPKRPLPRKQSDSSTYDCEAITQHHAFL
SSIHSSVLKDESETPAAGGPQLPEVSLGRFDFDVSDFFLFGSPLGLVLAMRRTVLPGLDG
FQVRPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADAL
HTHSPLFLEGSSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGAS
RITAKWWGSKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQVMRYESVNI
KESARLDPAALSPANPREKWLRKRTQVKLRNVTANHRANDVIAAEDGPQVLVGRFMYGPL
DMVALTGEKVDILVMAEPSSGRWVHLDTEITNSSGRITYNVPRPRRLGVGVYPVKMVVRG
DQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYMILY
ITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKISAAYG
STKDISVYSVLGLPASQIFIVGRPTKKYQTQCQFLSEGYAAHLAALEASHRSRPKKNNSR
MILRKGSFGLHAQPEFLRKRNHLRRTMSVQQPDPPAANPKPERAQSQPESDKDHERPLPA
LSWARGPPKFESVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F006	0.745	0.765	0.000	947	0.628	0.646	E7F006.pdb.gz	E7F006_DANRE Membrane-associated phosphatidylinositol transfer protein 3 OS=Danio rerio OX=7955 GN=pitpnm3 PE=3 SV=1
2	AFDB:M0RDK4	0.822	0.867	0.000	922	0.896	0.947	M0RDK4.pdb.gz	M0RDK4_RAT PITPNM family member 3 OS=Rattus norvegicus OX=10116 GN=Pitpnm3 PE=1 SV=3
3	AFDB:Q9BZ72	0.598	0.456	0.000	1349	0.566	0.408	Q9BZ72.pdb.gz	PITM2_HUMAN Membrane-associated phosphatidylinositol transfer protein 2 OS=Homo sapiens OX=9606 GN=PITPNM2 PE=1 SV=1
4	AFDB:A0A024R5I7	0.641	0.512	7.518E-101	1244	0.496	0.388	A0A024R5I7.pdb.gz
5	AFDB:P43125	0.581	0.462	1.605E-83	1259	0.410	0.317	P43125.pdb.gz	RDGB_DROME Protein retinal degeneration B OS=Drosophila melanogaster OX=7227 GN=rdgB PE=1 SV=2
6	AFDB:G5EED9	0.366	0.348	4.242E-61	1034	0.265	0.250	G5EED9.pdb.gz	G5EED9_CAEEL DDHD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pitp-1 PE=1 SV=1
7	AFDB:Q6NZC7	0.253	0.248	1.684E-11	998	0.104	0.101	Q6NZC7.pdb.gz	S23IP_MOUSE SEC23-interacting protein OS=Mus musculus OX=10090 GN=Sec23ip PE=1 SV=2
8	AFDB:Q9Y6Y8	0.240	0.234	7.550E-11	1000	0.100	0.097	Q9Y6Y8.pdb.gz	S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1
9	AFDB:A0A0B4JD27	0.184	0.172	3.126E-9	1045	0.097	0.090	A0A0B4JD27.pdb.gz	A0A0B4JD27_DROME Lipin, isoform E OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
10	AFDB:A0A0G2JW03	0.184	0.193	3.227E-8	924	0.104	0.109	A0A0G2JW03.pdb.gz	A0A0G2JW03_RAT phosphatidate phosphatase OS=Rattus norvegicus OX=10116 GN=Lpin1 PE=1 SV=2
11	PDB:4s3pA	0.069	0.096	1.139E-4	691	0.016	0.023	4s3pA.pdb.gz
12	PDB:3lpfA	0.122	0.171	4.831E-4	603	0.030	0.048	3lpfA.pdb.gz	Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
13	PDB:3l8eA	0.133	0.575	5.707E-4	185	0.026	0.135	3l8eA.pdb.gz	Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
14	PDB:2ia5H	0.108	0.314	7.966E-4	301	0.025	0.080	2ia5H.pdb.gz	Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
15	PDB:4edqA	0.077	0.137	1.112E-3	483	0.028	0.056	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
16	PDB:3oaiA	0.075	0.136	3.572E-3	488	0.016	0.033	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
17	PDB:4y5xB	0.076	0.457	3.572E-3	111	0.009	0.081	4y5xB.pdb.gz
18	PDB:4lnvB	0.082	0.075	3.992E-3	1063	0.012	0.011	4lnvB.pdb.gz
19	PDB:6hyjB	0.114	0.439	4.716E-3	223	0.023	0.099	6hyjB.pdb.gz	Crystal structures and snapshots along the reaction pathway of human phosphoserine phosphatase.
20	PDB:1l9mB	0.084	0.115	5.270E-3	681	0.007	0.010	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZTJ8	0.0	1781	958	0.919	0.934	A0A8I5ZTJ8_RAT PITPNM family member 3 OS=Rattus norvegicus OX=10116 GN=Pitpnm3 PE=3 SV=1
2	E7F006	0.0	1174	947	0.641	0.659	E7F006_DANRE Membrane-associated phosphatidylinositol transfer protein 3 OS=Danio rerio OX=7955 GN=pitpnm3 PE=3 SV=1
3	F1LXD6	0.0	1052	1331	0.562	0.411	F1LXD6_RAT Phosphatidylinositol transfer protein, membrane-associated 2 OS=Rattus norvegicus OX=10116 GN=Pitpnm2 PE=1 SV=3
4	M0RDK4	0.0	1818	974	0.932	0.932	M0RDK4_RAT PITPNM family member 3 OS=Rattus norvegicus OX=10116 GN=Pitpnm3 PE=1 SV=3
5	O00562	0.0	893	1244	0.494	0.387	PITM1_HUMAN Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1 PE=1 SV=4
6	P43125	0.0	717	1259	0.407	0.315	RDGB_DROME Protein retinal degeneration B OS=Drosophila melanogaster OX=7227 GN=rdgB PE=1 SV=2
7	Q5U2N3	0.0	899	1242	0.488	0.382	PITM1_RAT Membrane-associated phosphatidylinositol transfer protein 1 OS=Rattus norvegicus OX=10116 GN=Pitpnm1 PE=1 SV=1
8	Q6ZPQ6	0.0	1057	1335	0.565	0.412	PITM2_MOUSE Membrane-associated phosphatidylinositol transfer protein 2 OS=Mus musculus OX=10090 GN=Pitpnm2 PE=1 SV=2
9	Q9BZ71	0.0	2003	974	1.000	1.000	PITM3_HUMAN Membrane-associated phosphatidylinositol transfer protein 3 OS=Homo sapiens OX=9606 GN=PITPNM3 PE=1 SV=2
10	Q9BZ72	0.0	1063	1349	0.575	0.415	PITM2_HUMAN Membrane-associated phosphatidylinositol transfer protein 2 OS=Homo sapiens OX=9606 GN=PITPNM2 PE=1 SV=1
11	G5EED9	3.30e-114	378	1034	0.271	0.255	G5EED9_CAEEL DDHD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pitp-1 PE=1 SV=1
12	Q80Y98	2.14e-16	86.3	699	0.100	0.139	DDHD2_MOUSE Phospholipase DDHD2 OS=Mus musculus OX=10090 GN=Ddhd2 PE=1 SV=3
13	O94830	5.58e-13	75.5	711	0.099	0.135	DDHD2_HUMAN Phospholipase DDHD2 OS=Homo sapiens OX=9606 GN=DDHD2 PE=1 SV=2
14	M9MRD9	2.38e-09	63.5	663	0.064	0.094	M9MRD9_DROME Phosphatidic acid phospholipase A1, isoform B OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
15	H0YF17	1.30e-07	55.5	213	0.054	0.249	H0YF17_HUMAN DDHD domain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=DDHD2 PE=1 SV=1
16	Q12204	4.54e-07	56.2	715	0.051	0.070	YOR22_YEAST Probable phospholipase YOR022C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR022C PE=1 SV=1
17	Q8MQQ8	7.07e-07	55.8	1332	0.062	0.045	Q8MQQ8_DROME LD21041p (Fragment) OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=2 SV=1
18	Q8W5R2	8.71e-07	55.5	933	0.034	0.035	SHGR2_ARATH Phospholipase SGR2 OS=Arabidopsis thaliana OX=3702 GN=SGR2 PE=1 SV=1
19	Q80YA3	1.02e-06	55.1	547	0.031	0.055	DDHD1_MOUSE Phospholipase DDHD1 OS=Mus musculus OX=10090 GN=Ddhd1 PE=1 SV=1
20	Q8NEL9	1.34e-06	55.1	900	0.031	0.033	DDHD1_HUMAN Phospholipase DDHD1 OS=Homo sapiens OX=9606 GN=DDHD1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03767 Acid_phosphat_B	31	15.6	HAD superfamily, subfamily IIIB (Acid phosphatase)
2	PF02862 DDHD	1.5e-40	151.5	DDHD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262483

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479955	0.993	C-C motif chemokine 18
2	9606.ENSP00000380638	0.976	Protein-tyrosine kinase 2-beta
3	9606.ENSP00000370521	0.814	Aryl-hydrocarbon-interacting protein-like 1
4	9606.ENSP00000428417	0.749	Regulating synaptic membrane exocytosis protein 1
5	9606.ENSP00000377784	0.718	Guanylyl cyclase-activating protein 1
6	9606.ENSP00000337040	0.706	Protein unc-119 homolog A
7	9606.ENSP00000230381	0.683	Peripherin-2
8	9606.ENSP00000406220	0.642	Solute carrier family 13 member 5
9	9606.ENSP00000417175	0.642	Vesicle-associated membrane protein-associated protein B/C
10	9606.ENSP00000314444	0.638	WD repeat-containing protein 35
11	9606.ENSP00000254854	0.619	Retinal guanylyl cyclase 1
12	9606.ENSP00000354671	0.619	Microtubule-associated serine/threonine-protein kinase 2
13	9606.ENSP00000450456	0.610	Retina and anterior neural fold homeobox protein 2
14	9606.ENSP00000249887	0.606	Atypical chemokine receptor 4
15	9606.ENSP00000357268	0.604	Semaphorin-4A
16	9606.ENSP00000429969	0.602	Signal peptide, CUB domain and EGF like domain containing 2
17	9606.ENSP00000387739	0.572	Angiomotin-like protein 1
18	9606.ENSP00000485478	0.540	Cadherin-related family member 1
19	9606.ENSP00000371469	0.523	Cell cycle checkpoint protein RAD1
20	9606.ENSP00000221996	0.518	Cone-rod homeobox protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.435	catalytic activity
GO:0043167	0.362	ion binding
GO:0005102	0.354	signaling receptor binding
GO:0019899	0.334	enzyme binding
GO:0005319	0.322	lipid transporter activity
GO:0019901	0.315	protein kinase binding
GO:0008526	0.313	phosphatidylinositol transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0046486	0.993	glycerolipid metabolic process
GO:0006650	0.909	glycerophospholipid metabolic process
GO:0050794	0.735	regulation of cellular process
GO:0008654	0.675	phospholipid biosynthetic process
GO:0006661	0.660	phosphatidylinositol biosynthetic process
GO:0050896	0.357	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.990	cytosol
GO:0016020	0.837	membrane
GO:0043227	0.731	membrane-bounded organelle
GO:0043229	0.503	intracellular organelle
GO:0042995	0.432	cell projection
GO:0071944	0.377	cell periphery
GO:0043231	0.327	intracellular membrane-bounded organelle
GO:0044297	0.320	cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]