StarFunc result for job id Q9BZ72

User Input

>input (1349 residues)
MIIKEYRIPLPMTVEEYRIAQLYMIQKKSRNETYGEGSGVEILENRPYTDGPGGSGQYTH
KVYHVGMHIPSWFRSILPKAALRVVEESWNAYPYTRTRFTCPFVEKFSIDIETFYKTDAG
ENPDVFNLSPVEKNQLTIDFIDIVKDPVPHNEYKTEEDPKLFQSTKTQRGPLSENWIEEY
KKQVFPIMCAYKLCKVEFRYWGMQSKIERFIHDTGLRRVMVRAHRQAWCWQDEWYGLSME
NIRELEKEAQLMLSRKMAQFNEDGEEATELVKHEAVSDQTSGEPPEPSSSNGEPLVGRGL
KKQWSTSSKSSRSSKRGASPSRHSISEWRMQSIARDSDESSDDEFFDAHEDLSDTEEMFP
KDITKWSSNDLMDKIESPEPEDTQDGLYRQGAPEFRVASSVEQLNIIEDEVSQPLAAPPS
KIHVLLLVLHGGTILDTGAGDPSSKKGDANTIANVFDTVMRVHYPSALGRLAIRLVPCPP
VCSDAFALVSNLSPYSHDEGCLSSSQDHIPLAALPLLATSSPQYQEAVATVIQRANLAYG
DFIKSQEGMTFNGQVCLIGDCVGGILAFDALCYSNQPVSESQSSSRRGSVVSMQDNDLLS
PGILMNAAHCCGGGGGGGGGGGSSGGGGSSGGSSLESSRHLSRSNVDIPRSNGTEDPKRQ
LPRKRSDSSTYELDTIQQHQAFLSSLHASVLRTEPCSRHSSSSTMLDGTGALGRFDFEIT
DLFLFGCPLGLVLALRKTVIPALDVFQLRPACQQVYNLFHPADPSASRLEPLLERRFHAL
PPFSVPRYQRYPLGDGCSTLLADVLQTHNAAFQEHGAPSSPGTAPASRGFRRASEISIAS
QVSGMAESYTASSIAQKAPDALSHTPSVRRLSLLALPAPSPTTPGPHPPARKASPGLERA
PGLPELDIGEVAAKWWGQKRIDYALYCPDALTAFPTVALPHLFHASYWESTDVVSFLLRQ
VMRHDNSSILELDGKEVSVFTPSKPREKWQRKRTHVKLRNVTANHRINDALANEDGPQVL
TGRFMYGPLDMVTLTGEKVDVHIMTQPPSGEWLYLDTLVTNNSGRVSYTIPESHRLGVGV
YPIKMVVRGDHTFADSYITVLPKGTEFVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHW
QDLGYLIIYVTGRPDMQKQRVVAWLAQHNFPHGVVSFCDGLVHDPLRHKANFLKLLISEL
HLRVHAAYGSTKDVAVYSAISLSPMQIYIVGRPTKKLQQQCQFITDGYAAHLAQLKYSHR
ARPARNTATRMALRKGSFGLPGQGDFLRSRNHLLRTISAQPSGPSHRHERTQSQADGEQR
GQRSMSVAAGCWGRAMTGRLEPGAAAGPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R5I7	0.483	0.518	0.000	1244	0.529	0.573	A0A024R5I7.pdb.gz
2	AFDB:F1LXD6	0.523	0.545	0.000	1281	0.862	0.908	F1LXD6.pdb.gz	F1LXD6_RAT Phosphatidylinositol transfer protein, membrane-associated 2 OS=Rattus norvegicus OX=10116 GN=Pitpnm2 PE=1 SV=3
3	AFDB:P43125	0.512	0.542	0.000	1259	0.439	0.470	P43125.pdb.gz	RDGB_DROME Protein retinal degeneration B OS=Drosophila melanogaster OX=7227 GN=rdgB PE=1 SV=2
4	AFDB:Q9BZ72	0.999	0.999	0.000	1349	1.000	1.000	Q9BZ72.pdb.gz	PITM2_HUMAN Membrane-associated phosphatidylinositol transfer protein 2 OS=Homo sapiens OX=9606 GN=PITPNM2 PE=1 SV=1
5	AFDB:M0RDK4	0.436	0.601	5.428E-104	922	0.395	0.578	M0RDK4.pdb.gz	M0RDK4_RAT PITPNM family member 3 OS=Rattus norvegicus OX=10116 GN=Pitpnm3 PE=1 SV=3
6	AFDB:E7F006	0.409	0.551	3.547E-98	947	0.396	0.564	E7F006.pdb.gz	E7F006_DANRE Membrane-associated phosphatidylinositol transfer protein 3 OS=Danio rerio OX=7955 GN=pitpnm3 PE=3 SV=1
7	AFDB:G5EED9	0.346	0.430	9.153E-98	1034	0.322	0.420	G5EED9.pdb.gz	G5EED9_CAEEL DDHD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pitp-1 PE=1 SV=1
8	AFDB:F1QRW4	0.185	0.890	1.199E-28	272	0.089	0.441	F1QRW4.pdb.gz	F1QRW4_DANRE Phosphatidylinositol transfer protein beta isoform isoform 1 OS=Danio rerio OX=7955 GN=zgc:56092 PE=1 SV=1
9	AFDB:P48739	0.184	0.895	1.264E-28	271	0.087	0.435	P48739.pdb.gz	PIPNB_HUMAN Phosphatidylinositol transfer protein beta isoform OS=Homo sapiens OX=9606 GN=PITPNB PE=1 SV=2
10	PDB:2a1lA	0.185	0.908	3.874E-28	269	0.087	0.439	2a1lA.pdb.gz
11	PDB:1uw5A	0.186	0.903	2.356E-26	269	0.086	0.431	1uw5A.pdb.gz	Structure-Function Analysis of Human [Corrected] Phosphatidylinositol Transfer Protein Alpha Bound to Phosphatidylinositol.
12	PDB:3l8eA	0.103	0.620	1.327E-4	185	0.023	0.168	3l8eA.pdb.gz	Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
13	PDB:3jcmN	0.063	0.051	8.834E-4	1686	0.022	0.018	3jcmN.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
14	AFDB:Q1ECW2	0.036	0.048	9.675E-4	933	0.102	0.147	Q1ECW2.pdb.gz	NPS4A_DANRE Neuronal PAS domain-containing protein 4A OS=Danio rerio OX=7955 GN=npas4a PE=2 SV=1
15	PDB:4s3pA	0.053	0.099	9.815E-4	691	0.014	0.027	4s3pA.pdb.gz
16	PDB:3lpfA	0.093	0.174	1.091E-3	603	0.019	0.043	3lpfA.pdb.gz	Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
17	PDB:4f38B	0.059	0.299	1.752E-3	192	0.016	0.109	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
18	PDB:2ia5H	0.075	0.296	2.163E-3	301	0.019	0.083	2ia5H.pdb.gz	Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
19	PDB:6hyjB	0.092	0.499	2.163E-3	223	0.019	0.117	6hyjB.pdb.gz	Crystal structures and snapshots along the reaction pathway of human phosphoserine phosphatase.
20	PDB:5dcaA	0.062	0.045	3.296E-3	1948	0.027	0.018	5dcaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZTJ8	0.0	1081	958	0.417	0.587	A0A8I5ZTJ8_RAT PITPNM family member 3 OS=Rattus norvegicus OX=10116 GN=Pitpnm3 PE=3 SV=1
2	E7F006	0.0	985	947	0.399	0.568	E7F006_DANRE Membrane-associated phosphatidylinositol transfer protein 3 OS=Danio rerio OX=7955 GN=pitpnm3 PE=3 SV=1
3	F1LXD6	0.0	2278	1331	0.855	0.866	F1LXD6_RAT Phosphatidylinositol transfer protein, membrane-associated 2 OS=Rattus norvegicus OX=10116 GN=Pitpnm2 PE=1 SV=3
4	M0RDK4	0.0	1075	974	0.417	0.577	M0RDK4_RAT PITPNM family member 3 OS=Rattus norvegicus OX=10116 GN=Pitpnm3 PE=1 SV=3
5	O00562	0.0	1365	1244	0.537	0.582	PITM1_HUMAN Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1 PE=1 SV=4
6	P43125	0.0	1043	1259	0.441	0.473	RDGB_DROME Protein retinal degeneration B OS=Drosophila melanogaster OX=7227 GN=rdgB PE=1 SV=2
7	Q5U2N3	0.0	1353	1242	0.534	0.581	PITM1_RAT Membrane-associated phosphatidylinositol transfer protein 1 OS=Rattus norvegicus OX=10116 GN=Pitpnm1 PE=1 SV=1
8	Q6ZPQ6	0.0	2429	1335	0.893	0.903	PITM2_MOUSE Membrane-associated phosphatidylinositol transfer protein 2 OS=Mus musculus OX=10090 GN=Pitpnm2 PE=1 SV=2
9	Q9BZ71	0.0	608	974	0.212	0.294	PITM3_HUMAN Membrane-associated phosphatidylinositol transfer protein 3 OS=Homo sapiens OX=9606 GN=PITPNM3 PE=1 SV=2
10	Q9BZ72	0.0	2801	1349	1.000	1.000	PITM2_HUMAN Membrane-associated phosphatidylinositol transfer protein 2 OS=Homo sapiens OX=9606 GN=PITPNM2 PE=1 SV=1
11	G5EED9	9.65e-109	370	1034	0.120	0.157	G5EED9_CAEEL DDHD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pitp-1 PE=1 SV=1
12	Q9NCL7	2.25e-77	258	259	0.088	0.459	PITP2_DICDI Phosphatidylinositol transfer protein 2 OS=Dictyostelium discoideum OX=44689 GN=pitB PE=2 SV=1
13	A0A0C4DGP0	9.31e-71	240	268	0.083	0.418	A0A0C4DGP0_HUMAN Phosphatidylinositol transfer protein cytoplasmic 1 OS=Homo sapiens OX=9606 GN=PITPNC1 PE=1 SV=1
14	P53810	2.41e-70	239	271	0.085	0.424	PIPNA_MOUSE Phosphatidylinositol transfer protein alpha isoform OS=Mus musculus OX=10090 GN=Pitpna PE=1 SV=2
15	P16446	3.16e-70	238	271	0.085	0.424	PIPNA_RAT Phosphatidylinositol transfer protein alpha isoform OS=Rattus norvegicus OX=10116 GN=Pitpna PE=1 SV=2
16	Q8K4R4	1.04e-69	239	332	0.085	0.346	PITC1_MOUSE Cytoplasmic phosphatidylinositol transfer protein 1 OS=Mus musculus OX=10090 GN=Pitpnc1 PE=1 SV=1
17	Q00169	1.75e-69	236	270	0.086	0.430	PIPNA_HUMAN Phosphatidylinositol transfer protein alpha isoform OS=Homo sapiens OX=9606 GN=PITPNA PE=1 SV=2
18	Q2HJ54	1.99e-69	236	270	0.086	0.430	PIPNA_BOVIN Phosphatidylinositol transfer protein alpha isoform OS=Bos taurus OX=9913 GN=PITPNA PE=1 SV=3
19	Q9UKF7	3.95e-69	238	332	0.085	0.343	PITC1_HUMAN Cytoplasmic phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNC1 PE=1 SV=3
20	Q9NCL8	3.31e-68	232	264	0.084	0.428	PITP1_DICDI Phosphatidylinositol transfer protein 1 OS=Dictyostelium discoideum OX=44689 GN=pitA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03767 Acid_phosphat_B	1.7e+02	13.2	HAD superfamily, subfamily IIIB (Acid phosphatase)
2	PF02862 DDHD	1e-52	191.3	DDHD domain
3	PF02121 IP_trans	3.4e-105	362.7	Phosphatidylinositol transfer protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322218

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380638	0.883	Protein-tyrosine kinase 2-beta
2	9606.ENSP00000345656	0.837	Vesicle-associated membrane protein-associated protein A
3	9606.ENSP00000417175	0.823	Vesicle-associated membrane protein-associated protein B/C
4	9606.ENSP00000267113	0.752	Extended synaptotagmin-1
5	9606.ENSP00000338885	0.695	Phospholipid transfer protein C2CD2L
6	9606.ENSP00000368144	0.670	Proline-rich protein 5-like
7	9606.ENSP00000417569	0.666	Stromal interaction molecule 2
8	9606.ENSP00000379290	0.652	Breast carcinoma amplified sequence 1
9	9606.ENSP00000273814	0.637	Diacylglycerol kinase theta
10	9606.ENSP00000379696	0.611	cAMP-dependent protein kinase inhibitor alpha
11	9606.ENSP00000256255	0.598	Store-operated calcium entry-associated regulatory factor
12	9606.ENSP00000370521	0.594	Aryl-hydrocarbon-interacting protein-like 1
13	9606.ENSP00000327116	0.569	EH domain-containing protein 3
14	9606.ENSP00000264380	0.547	1-phosphatidylinositol 3-phosphate 5-kinase
15	9606.ENSP00000328405	0.545	Diacylglycerol kinase alpha
16	9606.ENSP00000250498	0.529	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
17	9606.ENSP00000360688	0.522	Thioredoxin domain-containing protein 12
18	9606.ENSP00000380544	0.519	2-oxoglutarate and iron dependent oxygenase domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008526	1.000	phosphatidylinositol transfer activity
GO:0005509	0.998	calcium ion binding
GO:0030971	0.997	receptor tyrosine kinase binding
GO:0005543	0.356	phospholipid binding
GO:0035091	0.346	phosphatidylinositol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0046488	0.975	phosphatidylinositol metabolic process
GO:0050896	0.972	response to stimulus
GO:0007154	0.953	cell communication
GO:0046474	0.943	glycerophospholipid biosynthetic process
GO:0006661	0.902	phosphatidylinositol biosynthetic process
GO:0023052	0.859	signaling
GO:0051716	0.859	cellular response to stimulus
GO:0007165	0.840	signal transduction
GO:0035556	0.713	intracellular signal transduction
GO:0048017	0.693	inositol lipid-mediated signaling
GO:0048015	0.589	phosphatidylinositol-mediated signaling
GO:0006810	0.419	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.959	cytosol
GO:0043227	0.876	membrane-bounded organelle
GO:0043229	0.863	intracellular organelle
GO:0043231	0.851	intracellular membrane-bounded organelle
GO:0016020	0.837	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]