StarFunc result for job id Q9BZ95

User Input

>input (1437 residues)
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYP
ATTEDLPPLTNGYPSSISVYETQTKYQSYNQYPNGSANGFGAVRNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEHTKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVSEKPRE
EPVLKEEAPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKSVASKTEVKKTR
RPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQ
DRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQATVKTGLQKGASEISDSCKPLKKRSRASTDVEMTSSAYRDTSDSDSRGLSD
LQVGFGKQVDSPSATADADVSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGE
CCKHFHLECLGLASLPDSKFICMECKTGQHPCFSCKVSGKDVKRCSVGACGKFYHEACVR
KFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSMLV
SSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAE
LMKLPMIPSSSASKKKCEKGGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHY
KQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFPYV
EGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKANK
VIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFT
KRLYPDAEIIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFY
MLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAGMELTFN
YNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRKIKTEPKQMH
EDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEF
CPHSFCKDHEKGALVPSALEGRLCCSEHDPMAPVSPEYWSKIKCKWESQDHGEEVKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P2L6	0.351	0.351	0.000	1439	0.918	0.917	Q6P2L6.pdb.gz	NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus OX=10090 GN=Nsd3 PE=1 SV=2
2	AFDB:Q96L73	0.222	0.133	6.882E-97	2696	0.377	0.201	Q96L73.pdb.gz	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
3	AFDB:O88491	0.219	0.137	1.344E-96	2588	0.373	0.207	O88491.pdb.gz	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
4	AFDB:E9Q5F9	0.154	0.091	6.544E-22	2537	0.165	0.093	E9Q5F9.pdb.gz	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
5	AFDB:Q9VW15	0.153	0.101	8.179E-22	2226	0.184	0.119	Q9VW15.pdb.gz	ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster OX=7227 GN=ash1 PE=1 SV=3
6	AFDB:Q9BYW2	0.146	0.084	3.686E-21	2564	0.167	0.094	Q9BYW2.pdb.gz	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
7	AFDB:Q9VYD1	0.151	0.096	6.808E-21	2313	0.165	0.102	Q9VYD1.pdb.gz	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2
8	AFDB:Q8IE95	0.156	0.091	3.925E-18	2548	0.158	0.089	Q8IE95.pdb.gz	SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=SETVS PE=2 SV=1
9	PDB:7td5F	0.106	0.330	6.541E-15	447	0.040	0.130	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
10	PDB:7td5A	0.109	0.300	1.596E-14	497	0.045	0.129	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
11	PDB:5wg6A	0.103	0.278	2.359E-14	517	0.038	0.106	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
12	PDB:5hynA	0.113	0.271	2.494E-14	581	0.040	0.100	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
13	PDB:7ksoA	0.109	0.386	3.485E-14	395	0.042	0.152	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
14	PDB:1pegA	0.123	0.586	1.257E-13	266	0.050	0.271	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
15	PDB:6wkrC	0.108	0.251	1.756E-13	606	0.040	0.094	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
16	AFDB:Q5LJZ2	0.101	0.089	2.962E-11	1641	0.150	0.132	Q5LJZ2.pdb.gz	SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster OX=7227 GN=Set1 PE=1 SV=1
17	AFDB:Q8CFT2	0.099	0.074	3.502E-11	1985	0.127	0.092	Q8CFT2.pdb.gz	SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus OX=10090 GN=Setd1b PE=1 SV=2
18	PDB:2g46A	0.068	0.680	5.257E-5	119	0.017	0.202	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
19	PDB:5h6zA	0.069	0.675	5.558E-5	123	0.015	0.171	5h6zA.pdb.gz
20	PDB:3qxyA	0.062	0.189	1.068E-3	420	0.015	0.050	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JIA4	0.0	889	1461	0.295	0.290	B8JIA4_DANRE Histone-lysine N-methyltransferase NSD2 OS=Danio rerio OX=7955 GN=fc12c04 PE=1 SV=1
2	O88491	0.0	941	2588	0.325	0.180	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
3	O96028	0.0	1125	1365	0.430	0.453	NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
4	Q6P2L6	0.0	2684	1439	0.919	0.917	NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus OX=10090 GN=Nsd3 PE=1 SV=2
5	Q8BVE8	0.0	1118	1365	0.422	0.445	NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus OX=10090 GN=Nsd2 PE=1 SV=2
6	Q96L73	0.0	942	2696	0.326	0.174	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
7	Q9BZ95	0.0	2997	1437	1.000	1.000	NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3 PE=1 SV=1
8	Q8MT36	5.43e-118	406	1427	0.161	0.163	NSD_DROME Nuclear receptor binding SET domain protein OS=Drosophila melanogaster OX=7227 GN=NSD PE=1 SV=2
9	D6R9V2	3.15e-54	197	392	0.079	0.291	D6R9V2_HUMAN Nuclear receptor binding SET domain protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
10	A0A8I6AUV5	7.07e-50	197	2426	0.069	0.041	A0A8I6AUV5_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
11	A0A0G2KB10	7.48e-50	197	2523	0.069	0.039	A0A0G2KB10_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
12	A0A8I6A5I9	7.81e-50	197	2526	0.069	0.039	A0A8I6A5I9_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
13	A0A8I5ZLS2	8.02e-50	197	2419	0.069	0.041	A0A8I5ZLS2_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
14	A0A8I6A709	8.78e-50	197	2520	0.069	0.039	A0A8I6A709_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
15	D4A5H6	8.82e-50	197	2294	0.069	0.043	D4A5H6_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=2
16	E9Q5F9	1.04e-49	197	2537	0.069	0.039	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
17	Q2LAE1	1.04e-49	196	1759	0.063	0.052	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
18	Q9BYW2	1.89e-49	196	2564	0.069	0.039	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
19	Q55FF7	7.41e-49	191	898	0.065	0.105	Q55FF7_DICDI SET domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268132 PE=4 SV=1
20	Q99MY8	2.94e-45	182	2958	0.065	0.031	ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus OX=10090 GN=Ash1l PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17907 AWS	1.4e-13	61.9	AWS domain
2	PF17982 C5HCH	3.3e-23	92.9	NSD Cys-His rich domain
3	PF00628 PHD	4.5e-06	37.8	PHD-finger
4	PF00855 PWWP	7.6e-35	130.6	PWWP domain
5	PF00856 SET	1.4e-16	72.8	SET domain
6	PF13771 zf-HC5HC2H	21	16.7	PHD-like zinc-binding domain
7	PF13832 zf-HC5HC2H_2	24	16.5	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313983

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263377	0.999	Bromodomain-containing protein 4
2	9606.ENSP00000297792	0.945	Lysine-specific histone demethylase 1B
3	9606.ENSP00000355657	0.939	Histone H3.1t
4	9606.ENSP00000244537	0.935	Histone cluster 1 H4 family member f
5	9606.ENSP00000476960	0.931	Histone cluster 2 H3 pseudogene 2
6	9606.ENSP00000480826	0.913	Histone cluster 1 H3 family member a
7	9606.ENSP00000347168	0.879	Histone cluster 1 H4 family member j
8	9606.ENSP00000366956	0.879	Histone cluster 1 H4 family member h
9	9606.ENSP00000366974	0.879	Histone cluster 1 H4 family member b
10	9606.ENSP00000367034	0.879	Histone cluster 1 H4 family member c
11	9606.ENSP00000443017	0.879	Histone cluster 4, H4
12	9606.ENSP00000462355	0.879	Histone cluster 2 H4 family member b
13	9606.ENSP00000462667	0.879	Histone cluster 2 H4 family member a
14	9606.ENSP00000479106	0.879	Histone cluster 1 H4 family member a
15	9606.ENSP00000479461	0.879	Histone cluster 1 H4 family member d
16	9606.ENSP00000479794	0.879	Histone cluster 1 H4 family member k
17	9606.ENSP00000480960	0.879	Histone cluster 1 H4 family member l
18	9606.ENSP00000481486	0.879	Histone cluster 1 H4 family member i
19	9606.ENSP00000484789	0.879	Histone H4
20	9606.ENSP00000254810	0.853	H3 histone, family 3B (H3.3B)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140938	1.000	histone H3 methyltransferase activity
GO:0018024	1.000	histone lysine N-methyltransferase activity
GO:0005515	0.996	protein binding
GO:0042800	0.991	histone H3K4 methyltransferase activity
GO:0046975	0.799	histone H3K36 methyltransferase activity
GO:0003676	0.641	nucleic acid binding
GO:0140677	0.627	molecular function activator activity
GO:0046976	0.562	histone H3K27 methyltransferase activity
GO:0003677	0.375	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0080090	0.980	regulation of primary metabolic process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0019219	0.966	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.947	regulation of RNA metabolic process
GO:0031326	0.945	regulation of cellular biosynthetic process
GO:0006355	0.943	regulation of DNA-templated transcription
GO:0048518	0.893	positive regulation of biological process
GO:0048522	0.777	positive regulation of cellular process
GO:0010604	0.685	positive regulation of macromolecule metabolic process
GO:0051173	0.663	positive regulation of nitrogen compound metabolic process
GO:0031325	0.661	positive regulation of cellular metabolic process
GO:0048519	0.659	negative regulation of biological process
GO:0045935	0.646	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.645	negative regulation of cellular process
GO:0009987	0.466	cellular process
GO:0051254	0.462	positive regulation of RNA metabolic process
GO:0031328	0.451	positive regulation of cellular biosynthetic process
GO:0010557	0.450	positive regulation of macromolecule biosynthetic process
GO:0009892	0.428	negative regulation of metabolic process
GO:0045893	0.417	positive regulation of DNA-templated transcription
GO:0010605	0.407	negative regulation of macromolecule metabolic process
GO:0051253	0.388	negative regulation of RNA metabolic process
GO:0045892	0.384	negative regulation of DNA-templated transcription
GO:0071704	0.324	organic substance metabolic process
GO:0044238	0.313	primary metabolic process
GO:0043170	0.304	macromolecule metabolic process
GO:0006807	0.302	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.847	protein-containing complex
GO:0043232	0.536	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine
RHEA:60260	0.991	L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine
EC:2.1.1.354	0.991	[histone H3]-lysine(4) N-trimethyltransferase.
EC:2.1.1.356	0.562	[histone H3]-lysine(27) N-trimethyltransferase.

[back to server]