StarFunc result for job id Q9BZA8

User Input

>input (1340 residues)
MFRVGFLIISSSSSLSPLLLVSVVRVNTTNCHKCLLSGTYIFAVLLVCVVFHSGAQEKNY
TIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTG
ARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISI
PENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELD
REEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV
TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVL
ASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDK
DADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQ
SAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPD
APPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP
VFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPN
ISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPS
TNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHR
VLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTS
DYVKILVAAVAGTITVVVVIFITAVVRCRQAPHLKAAQKNMQNSEWATPNPENRQMIMMK
KKKKKKKHSPKNLLLNVVTIEETKADDVDSDGNRVTLDLPIDLEEQTMGKYNWVTTPTTF
KPDSPDLARHYKSASPQPAFQIQPETPLNLKHHIIQELPLDNTFVACDSISNCSSSSSDP
YSVSDCGYPVTTFEVPVSVHTRPSQRRVTFHLPEGSQESSSDGGLGDHDAGSLTSTSHGL
PLGYPQEEYFDRATPSNRTEGDGNSDPESTFIPGLKKEITVQPTVEEASDNCTQECLIYG
HSDACWMPASLDHSSSSQAQASALCHSPPLSQASTQHHSPPVTQTIVLCHSPPVTQTIAL
CHSPPPIQVSALHHSPPLVQGTALHHSPPSAQASALCYSPPLAQAAAISHSSSLPQVIAL
HRSQAQSSVSLQQGWVQGANGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTFA
PRQQARPSRGDSPIMETHPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A6YWY8	0.488	0.537	0.000	1203	0.487	0.543	A0A0A6YWY8.pdb.gz	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
2	AFDB:B2RY69	0.483	0.519	0.000	1237	0.488	0.529	B2RY69.pdb.gz	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
3	AFDB:F6ZNL5	0.418	0.419	0.000	1338	0.799	0.800	F6ZNL5.pdb.gz	F6ZNL5_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
4	AFDB:Q9BZA7	0.528	0.525	0.000	1347	0.956	0.951	Q9BZA7.pdb.gz	PC11X_HUMAN Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1
5	AFDB:Q9BZA8	1.000	1.000	0.000	1340	1.000	1.000	Q9BZA8.pdb.gz	PC11Y_HUMAN Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1
6	AFDB:A0A0R4IZF0	0.144	0.110	3.546E-62	1907	0.225	0.158	A0A0R4IZF0.pdb.gz
7	AFDB:Q96QU1	0.145	0.101	7.896E-57	1955	0.218	0.149	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
8	AFDB:Q967D7	0.133	0.122	1.647E-25	1531	0.134	0.118	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
9	AFDB:D3ZB51	0.118	0.119	3.072E-25	1328	0.141	0.142	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
10	AFDB:Q9W213	0.147	0.143	3.474E-23	1395	0.143	0.138	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
11	PDB:7sqcO0	0.116	0.130	4.789E-17	1140	0.070	0.082	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:6velC	0.129	0.750	4.634E-15	209	0.046	0.292	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:4aq1A	0.088	0.139	3.515E-14	721	0.059	0.110	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:1e07A	0.122	0.194	5.326E-14	642	0.056	0.117	1e07A.pdb.gz
15	PDB:5oj2B	0.102	0.169	2.958E-13	692	0.075	0.146	5oj2B.pdb.gz
16	PDB:7vonA	0.074	0.072	1.735E-9	1399	0.063	0.061	7vonA.pdb.gz
17	PDB:7q1yA	0.080	0.079	1.069E-8	1374	0.069	0.068	7q1yA.pdb.gz
18	PDB:7q5zA	0.065	0.065	3.022E-8	1344	0.071	0.071	7q5zA.pdb.gz
19	PDB:6h03A	0.073	0.077	3.353E-8	1223	0.068	0.074	6h03A.pdb.gz
20	PDB:4lnvA	0.067	0.070	5.638E-8	1276	0.067	0.071	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087X2C4	578	1269	0.285	0.301	A0A087X2C4_HUMAN Protocadherin 7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2
2	A0A0A6YWK0	1733	1026	0.640	0.835	A0A0A6YWK0_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
3	A0A0A6YWM0	1002	873	0.372	0.570	A0A0A6YWM0_MOUSE Protocadherin 9 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
4	A0A0A6YWY8	1264	1203	0.481	0.536	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
5	A0A0A6YY09	1196	1195	0.463	0.520	A0A0A6YY09_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
6	A0A0A6YY37	1074	1038	0.413	0.533	A0A0A6YY37_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
7	A0A0A6YY83	586	1255	0.283	0.302	A0A0A6YY83_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
8	A0A8I5ZK96	1251	1237	0.485	0.525	A0A8I5ZK96_RAT Protocadherin 9 OS=Rattus norvegicus OX=10116 GN=Pcdh9 PE=4 SV=1
9	A0JNT1	1842	1128	0.684	0.812	A0JNT1_MOUSE Pcdh11x protein OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
10	B1AZR7	2137	1320	0.795	0.807	B1AZR7_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
11	B2RXR7	1193	1161	0.461	0.532	B2RXR7_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
12	B2RY66	1265	1203	0.481	0.536	B2RY66_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
13	B2RY69	1249	1237	0.484	0.525	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
14	B5AK95	942	553	0.336	0.814	B5AK95_MOUSE Protocadherin X-linked 11 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh11x PE=2 SV=1
15	E9Q2S0	585	1247	0.285	0.306	E9Q2S0_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=2
16	E9Q622	2112	1334	0.789	0.792	E9Q622_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
17	F1LS01	1268	1203	0.482	0.537	F1LS01_RAT Protocadherin 9 OS=Rattus norvegicus OX=10116 GN=Pcdh9 PE=4 SV=4
18	F6ZNL5	2152	1338	0.800	0.801	F6ZNL5_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
19	F7BJK1	624	1077	0.306	0.381	F7BJK1_MOUSE Protocadherin 1 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh1 PE=1 SV=1
20	F8VPK8	1249	1237	0.484	0.525	F8VPK8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	1.3e-101	344.6	Cadherin domain
2	PF08266 Cadherin_2	1.4e-18	77.9	Cadherin-like
3	PF16184 Cadherin_3	0.022	26.1	Cadherin-like
4	PF06346 Drf_FH1	3.3e+02	12.5	Formin Homology Region 1
5	PF19904 DUF6377	46	15.0	Domain of unknown function (DUF6377)
6	PF14642 FAM47	33	15.4	FAM47 family
7	PF08374 Protocadherin	7.9e-79	276.2	Protocadherin
8	PF17756 RET_CLD1	5.6	18.7	RET Cadherin like domain 1
9	PF05633 ROH1-like	1.1e+02	13.2	Protein ROH1-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000037987

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000015634	0.778	Junction plakoglobin
2	9598.ENSPTRP00000004598	0.760	Vinculin
3	9598.ENSPTRP00000037595	0.738	Uncharacterized protein
4	9598.ENSPTRP00000037983	0.733	May have a transcription role in testis
5	9598.ENSPTRP00000038447	0.706	Vestigial-like family member 1
6	9598.ENSPTRP00000011701	0.704	Tight junction protein 1 (Zona occludens 1)
7	9598.ENSPTRP00000037088	0.704	Transducin beta like 1, Y-linked
8	9598.ENSPTRP00000031615	0.697	Tyrosine-protein kinase
9	9598.ENSPTRP00000037047	0.682	Glycogenin 2
10	9598.ENSPTRP00000056253	0.676	Polyadenylate-binding protein 5
11	9598.ENSPTRP00000038022	0.669	Centromere protein I
12	9598.ENSPTRP00000027253	0.660	Spondin 2, extracellular matrix protein
13	9598.ENSPTRP00000006308	0.653	Apelin receptor
14	9598.ENSPTRP00000037999	0.632	Pan troglodytes sushi-repeat containing protein, X-linked 2 (SRPX2), mRNA
15	9598.ENSPTRP00000048221	0.627	Uncharacterized protein
16	9598.ENSPTRP00000038193	0.620	Uncharacterized protein
17	9598.ENSPTRP00000037252	0.619	Eukaryotic translation initiation factor 1A, X-linked
18	9598.ENSPTRP00000037292	0.616	Uncharacterized protein
19	9598.ENSPTRP00000038749	0.616	Zinc finger Y-chromosomal protein
20	9598.ENSPTRP00000040734	0.615	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.970	regulation of cellular process
GO:0032501	0.969	multicellular organismal process
GO:0032502	0.956	developmental process
GO:0048518	0.817	positive regulation of biological process
GO:0009987	0.800	cellular process
GO:0023051	0.787	regulation of signaling
GO:0048583	0.766	regulation of response to stimulus
GO:0010646	0.758	regulation of cell communication
GO:0009966	0.729	regulation of signal transduction
GO:0048522	0.703	positive regulation of cellular process
GO:0048856	0.615	anatomical structure development
GO:0007275	0.401	multicellular organism development
GO:0023056	0.400	positive regulation of signaling
GO:0010647	0.367	positive regulation of cell communication
GO:0048731	0.360	system development
GO:0048584	0.352	positive regulation of response to stimulus
GO:0000003	0.351	reproduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0005886	0.989	plasma membrane
GO:0042995	0.955	cell projection
GO:0120025	0.743	plasma membrane bounded cell projection
GO:0043226	0.667	organelle
GO:0043227	0.646	membrane-bounded organelle
GO:0043231	0.621	intracellular membrane-bounded organelle
GO:0030054	0.453	cell junction
GO:0005737	0.330	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]