StarFunc result for job id Q9BZB8

User Input

>input (566 residues)
MALSLEEEAGRIKDCWDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHD
HLPDFQDSEETVTSRMLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSA
QSSTHSVLSMLHNPLGNVLGKPPLSFLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRS
SSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLSLSGGGPRDPLKMGVGSRMDQEQAAL
AAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQAAAVNEATCTWSGQLP
PRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKG
YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVR
SPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNN
QRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSC
WHWRHSMEGLRHHSPLMRNQKNRDSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R214	0.556	0.505	5.505E-96	626	0.984	0.890	A0A024R214.pdb.gz	A0A024R214_HUMAN Cytoplasmic polyadenylation element binding protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
2	AFDB:Q91572	0.571	0.569	8.717E-86	568	0.800	0.798	Q91572.pdb.gz	CPE1A_XENLA Cytoplasmic polyadenylation element-binding protein 1-A OS=Xenopus laevis OX=8355 GN=cpeb1-a PE=1 SV=2
3	AFDB:Q9YGX5	0.541	0.548	4.578E-77	559	0.671	0.680	Q9YGX5.pdb.gz	CPEB1_DANRE Cytoplasmic polyadenylation element-binding protein 1 OS=Danio rerio OX=7955 GN=cpeb1 PE=1 SV=1
4	AFDB:Q28CH2	0.389	0.351	2.119E-32	632	0.299	0.267	Q28CH2.pdb.gz	CPEB3_XENTR Cytoplasmic polyadenylation element-binding protein 3 OS=Xenopus tropicalis OX=8364 GN=cpeb3 PE=2 SV=1
5	AFDB:D4AD99	0.382	0.292	4.088E-32	756	0.267	0.200	D4AD99.pdb.gz	D4AD99_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=1 SV=3
6	AFDB:Q7TN99	0.384	0.309	7.001E-32	716	0.284	0.225	Q7TN99.pdb.gz	CPEB3_MOUSE Cytoplasmic polyadenylation element-binding protein 3 OS=Mus musculus OX=10090 GN=Cpeb3 PE=1 SV=1
7	AFDB:D3ZHK8	0.389	0.312	2.313E-31	717	0.269	0.212	D3ZHK8.pdb.gz	D3ZHK8_RAT Cytoplasmic polyadenylation element binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cpeb2 PE=1 SV=4
8	AFDB:A0A384N5Z8	0.140	0.113	1.647E-9	707	0.145	0.116	A0A384N5Z8.pdb.gz	A0A384N5Z8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
9	AFDB:Q9FVQ1	0.130	0.131	6.134E-9	557	0.133	0.135	Q9FVQ1.pdb.gz	NUCL1_ARATH Nucleolin 1 OS=Arabidopsis thaliana OX=3702 GN=NUCL1 PE=1 SV=1
10	AFDB:Q1PEP5	0.137	0.125	9.585E-8	636	0.141	0.126	Q1PEP5.pdb.gz	NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana OX=3702 GN=NUCL2 PE=1 SV=1
11	PDB:7oqcF	0.108	0.215	1.403E-6	267	0.071	0.150	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
12	PDB:6y53o	0.178	0.486	9.495E-6	160	0.041	0.144	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	PDB:6y5qq	0.113	0.314	2.622E-5	178	0.055	0.174	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:7evoD	0.116	0.301	3.984E-5	200	0.067	0.190	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
15	PDB:5vsuA	0.122	0.174	5.372E-5	387	0.048	0.070	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
16	PDB:6qx91K	0.121	0.306	8.665E-5	201	0.042	0.119	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
17	PDB:6r5kH	0.127	0.176	5.204E-4	394	0.069	0.099	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
18	PDB:5yzg1	0.118	0.240	6.609E-4	243	0.055	0.128	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:5lsbA	0.119	0.354	7.449E-4	176	0.046	0.148	5lsbA.pdb.gz
20	PDB:7dvqY	0.118	0.426	1.526E-3	140	0.034	0.136	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R214	0.0	1164	626	1.000	0.904	A0A024R214_HUMAN Cytoplasmic polyadenylation element binding protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
2	A0A087WXG7	0.0	1142	588	0.984	0.947	A0A087WXG7_HUMAN Cytoplasmic polyadenylation element binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
3	A0A087X171	0.0	1147	561	0.991	1.000	A0A087X171_HUMAN Cytoplasmic polyadenylation element-binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
4	A4PES2	0.0	1134	566	0.972	0.972	A4PES2_PIG Cytoplasmic polyadenylation element binding protein 1 OS=Sus scrofa OX=9823 GN=CPEB1 PE=2 SV=1
5	P0C279	0.0	1074	561	0.945	0.954	CPEB1_RAT Cytoplasmic polyadenylation element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Cpeb1 PE=1 SV=1
6	P70166	0.0	1054	561	0.952	0.961	CPEB1_MOUSE Cytoplasmic polyadenylation element-binding protein 1 OS=Mus musculus OX=10090 GN=Cpeb1 PE=1 SV=1
7	Q91572	0.0	915	568	0.809	0.806	CPE1A_XENLA Cytoplasmic polyadenylation element-binding protein 1-A OS=Xenopus laevis OX=8355 GN=cpeb1-a PE=1 SV=2
8	Q9BZB8	0.0	1164	566	1.000	1.000	CPEB1_HUMAN Cytoplasmic polyadenylation element-binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
9	Q9YGX5	0.0	750	559	0.673	0.682	CPEB1_DANRE Cytoplasmic polyadenylation element-binding protein 1 OS=Danio rerio OX=7955 GN=cpeb1 PE=1 SV=1
10	Q967R6	2.83e-138	419	687	0.337	0.278	CPEB_APLCA Cytoplasmic polyadenylation element-binding protein OS=Aplysia californica OX=6500 PE=1 SV=1
11	Q8IMZ2	1.50e-127	387	559	0.304	0.308	Q8IMZ2_DROME Oo18 RNA-binding protein, isoform C OS=Drosophila melanogaster OX=7227 GN=orb PE=4 SV=1
12	Q8IHC3	1.67e-127	389	617	0.304	0.279	Q8IHC3_DROME AT14906p OS=Drosophila melanogaster OX=7227 GN=orb PE=2 SV=1
13	Q8IHE0	2.51e-127	387	582	0.304	0.296	Q8IHE0_DROME AT10134p (Fragment) OS=Drosophila melanogaster OX=7227 GN=orb PE=2 SV=1
14	Q8IMZ3	2.89e-125	391	913	0.304	0.188	Q8IMZ3_DROME Oo18 RNA-binding protein, isoform B OS=Drosophila melanogaster OX=7227 GN=orb PE=4 SV=1
15	Q9VCN7	7.78e-125	390	915	0.304	0.188	Q9VCN7_DROME FI20148p1 OS=Drosophila melanogaster OX=7227 GN=orb PE=2 SV=1
16	Q24433	1.35e-123	387	915	0.302	0.187	Q24433_DROME Ovarian protein OS=Drosophila melanogaster OX=7227 GN=orb PE=2 SV=1
17	Q812E0	6.40e-61	212	521	0.210	0.228	CPEB2_MOUSE Cytoplasmic polyadenylation element-binding protein 2 OS=Mus musculus OX=10090 GN=Cpeb2 PE=1 SV=1
18	Q28CH2	1.25e-60	213	632	0.203	0.182	CPEB3_XENTR Cytoplasmic polyadenylation element-binding protein 3 OS=Xenopus tropicalis OX=8364 GN=cpeb3 PE=2 SV=1
19	Q5QP71	1.48e-60	214	684	0.203	0.168	Q5QP71_HUMAN Cytoplasmic polyadenylation element binding protein 3, isoform CRA_a OS=Homo sapiens OX=9606 GN=CPEB3 PE=2 SV=1
20	Q7Z5Q1	1.62e-60	212	589	0.210	0.202	CPEB2_HUMAN Cytoplasmic polyadenylation element-binding protein 2 OS=Homo sapiens OX=9606 GN=CPEB2 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16368 CEBP1_N	1.4e-155	529.0	Cytoplasmic polyadenylation element-binding protein 1 N-terminus
2	PF16366 CEBP_ZZ	9.6e-24	94.7	Cytoplasmic polyadenylation element-binding protein ZZ domain
3	PF00076 RRM_1	0.00024	32.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	1.5e-35	132.5	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010359141.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010379936.1	0.948	Boule homolog, RNA binding protein
2	61622.XP_010354995.1	0.943	Belongs to the protein kinase superfamily.
3	61622.XP_010365776.1	0.917	DEAD-box helicase 6
4	61622.XP_010357918.1	0.911	LSM14A, mRNA processing body assembly factor
5	61622.XP_010372546.1	0.895	Belongs to the cyclin family.
6	61622.XP_010384301.1	0.882	poly(A) RNA polymerase GLD2 isoform X1
7	61622.XP_010363257.1	0.877	Belongs to the protein kinase superfamily.
8	61622.XP_010356528.1	0.873	Polo like kinase 1
9	61622.XP_010375756.1	0.871	Symplekin
10	61622.XP_010371642.1	0.830	Cytoplasmic polyadenylation element binding protein 4
11	61622.XP_010379619.1	0.830	Cytoplasmic polyadenylation element binding protein 3
12	61622.XP_010351879.1	0.828	Pumilio RNA binding family member 1
13	61622.XP_010382557.1	0.827	Binds the poly(A) tail of mRNA.
14	61622.XP_010356407.1	0.822	Cytoplasmic polyadenylation element binding protein 2
15	61622.XP_010363832.1	0.809	Eukaryotic translation initiation factor 4E
16	61622.XP_010374257.1	0.807	Fragile X mental retardation 1
17	61622.XP_010358473.1	0.783	Binds the poly(A) tail of mRNA.
18	61622.XP_010372474.1	0.783	Binds the poly(A) tail of mRNA.
19	61622.XP_010359475.1	0.773	OTU domain-containing protein 4 isoform X1
20	61622.XP_010358062.1	0.769	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 211 ESTs, 22 Proteins, and 82% coverage of the annotated genomic feature by RNAseq alignments

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.972	mRNA binding
GO:0003730	0.497	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0080090	0.993	regulation of primary metabolic process
GO:0031323	0.993	regulation of cellular metabolic process
GO:0010468	0.993	regulation of gene expression
GO:0051173	0.990	positive regulation of nitrogen compound metabolic process
GO:0051246	0.984	regulation of protein metabolic process
GO:2000112	0.977	regulation of cellular macromolecule biosynthetic process
GO:0009987	0.974	cellular process
GO:0006417	0.967	regulation of translation
GO:0048522	0.960	positive regulation of cellular process
GO:0048519	0.871	negative regulation of biological process
GO:0010604	0.866	positive regulation of macromolecule metabolic process
GO:0031325	0.853	positive regulation of cellular metabolic process
GO:0048523	0.834	negative regulation of cellular process
GO:0009892	0.743	negative regulation of metabolic process
GO:0017148	0.696	negative regulation of translation
GO:0050896	0.625	response to stimulus
GO:0051247	0.529	positive regulation of protein metabolic process
GO:0008152	0.504	metabolic process
GO:0010628	0.494	positive regulation of gene expression
GO:0051716	0.483	cellular response to stimulus
GO:0071704	0.466	organic substance metabolic process
GO:0044237	0.427	cellular metabolic process
GO:0032502	0.391	developmental process
GO:0045727	0.377	positive regulation of translation
GO:0032501	0.345	multicellular organismal process
GO:0044238	0.344	primary metabolic process
GO:0043170	0.337	macromolecule metabolic process
GO:0051252	0.325	regulation of RNA metabolic process
GO:0006807	0.305	nitrogen compound metabolic process
GO:0048856	0.302	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0043226	0.979	organelle
GO:0043229	0.969	intracellular organelle
GO:0043227	0.951	membrane-bounded organelle
GO:0043231	0.930	intracellular membrane-bounded organelle
GO:0005634	0.913	nucleus
GO:0043233	0.887	organelle lumen
GO:0005829	0.884	cytosol
GO:0031981	0.881	nuclear lumen
GO:0005654	0.871	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]