StarFunc result for job id Q9BZC7

User Input

>input (2435 residues)
MGFLHQLQLLLWKNVTLKRRSPWVLAFEIFIPLVLFFILLGLRQKKPTISVKEAFYTAAP
LTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPSLGSEL
EALRQHLEALSAGPGTSGSHLDRSTVSSFSLDSVARNPQELWRFLTQNLSLPNSTAQALL
AARVDPPEVYHLLFGPSSALDSQSGLHKGQEPWSRLGGNPLFRMEELLLAPALLEQLTCT
PGSGELGRILTVPESQKGALQGYRDAVCSGQAAARARRFSGLSAELRNQLDVAKVSQQLG
LDAPNGSDSSPQAPPPRRLQALLGDLLDAQKVLQDVDVLSALALLLPQGACTGRTPGPPA
SGAGGAANGTGAGAVMGPNATAEEGAPSAAALATPDTLQGQCSAFVQLWAGLQPILCGNN
RTIEPEALRRGNMSSLGFTSKEQRNLGLLVHLMTSNPKILYAPAGSEVDRVILKANETFA
FVGNVTHYAQVWLNISAEIRSFLEQGRLQQHLRWLQQYVAELRLHPEALNLSLDELPPAL
RQDNFSLPSGMALLQQLDTIDNAACGWIQFMSKVSVDIFKGFPDEESIVNYTLNQAYQDN
VTVFASVIFQTRKDGSLPPHVHYKIRQNSSFTEKTNEIRRAYWRPGPNTGGRFYFLYGFV
WIQDMMERAIIDTFVGHDVVEPGSYVQMFPYPCYTRDDFLFVIEHMMPLCMVISWVYSVA
MTIQHIVAEKEHRLKEVMKTMGLNNAVHWVAWFITGFVQLSISVTALTAILKYGQVLMHS
HVVIIWLFLAVYAVATIMFCFLVSVLYSKAKLASACGGIIYFLSYVPYMYVAIREEVAHD
KITAFEKCIASLMSTTAFGLGSKYFALYEVAGVGIQWHTFSQSPVEGDDFNLLLAVTMLM
VDAVVYGILTWYIEAVHPGMYGLPRPWYFPLQKSYWLGSGRTEAWEWSWPWARTPRLSVM
EEDQACAMESRRFEETRGMEEEPTHLPLVVCVDKLTKVYKDDKKLALNKLSLNLYENQVV
SFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLT
VEEHLWFYSRLKSMAQEEIRREMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGG
SRAIILDEPTAGVDPYARRAIWDLILKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLK
CCGSPLFLKGTYGDGYRLTLVKRPAEPGGPQEPGLASSPPGRAPLSSCSELQVSQFIRKH
VASCLLVSDTSTELSYILPSEAAKKGAFERLFQHLERSLDALHLSSFGLMDTTLEEVFLK
VSEEDQSLENSEADVKESRKDVLPGAEGPASGEGHAGNLARCSELTQSQASLQSASSVGS
ARGDEGAGYTDVYGDYRPLFDNPQDPDNVSLQEVEAEALSRVGQGSRKLDGGWLKVRQFH
GLLVKRFHCARRNSKALFSQILLPAFFVCVAMTVALSVPEIGDLPPLVLSPSQYHNYTQP
RGNFIPYANEERREYRLRLSPDASPQQLVSTFRLPSGVGATCVLKSPANGSLGPTLNLSS
GESRLLAARFFDSMCLESFTQGLPLSNFVPPPPSPAPSDSPASPDEDLQAWNVSLPPTAG
PEMWTSAPSLPRLVREPVRCTCSAQGTGFSCPSSVGGHPPQMRVVTGDILTDITGHNVSE
YLLFTSDRFRLHRYGAITFGNVLKSIPASFGTRAPPMVRKIAVRRAAQVFYNNKGYHSMP
TYLNSLNNAILRANLPKSKGNPAAYGITVTNHPMNKTSASLSLDYLLQGTDVVIAIFIIV
AMSFVPASFVVFLVAEKSTKAKHLQFVSGCNPIIYWLANYVWDMLNYLVPATCCVIILFV
FDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATV
ATFLLQLFEHDKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKMK
SPFEWDIVTRGLVAMAVEGVVGFLLTIMCQYNFLRRPQRMPVSTKPVEDDVDVASERQRV
LRGDADNDMVKIENLTKVYKSRKIGRILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKML
TGDESTTGGEAFVNGHSVLKELLQVQQSLGYCPQCDALFDELTAREHLQLYTRLRGISWK
DEARVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKA
RRFLWNLILDLIKTGRSVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGY
MITVRTKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVSGV
LGIEDYSVSQTTLDNVFVNFAKKQSDNLEQQETEPPSALQSPLGCLLSLLRPRSAPTELR
ALVADEPEDLDTEDEGLISFEEERAQLSFNTDTLC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7e7iA	0.603	0.720	0.000	2011	0.336	0.407	7e7iA.pdb.gz
2	PDB:7e7qA	0.604	0.738	0.000	1958	0.335	0.417	7e7qA.pdb.gz	Structural basis of substrate recognition and translocation by human ABCA4.
3	PDB:7lkzA	0.619	0.772	0.000	1920	0.336	0.426	7lkzA.pdb.gz	Molecular structures of the eukaryotic retinal importer ABCA4.
4	PDB:7m1pA	0.592	0.730	0.000	1938	0.320	0.401	7m1pA.pdb.gz
5	PDB:7roqA	0.539	0.696	0.000	1831	0.320	0.425	7roqA.pdb.gz	Structure of the Human Lipid Exporter ABCA1.
6	PDB:7tbwA	0.638	0.793	0.000	1928	0.362	0.457	7tbwA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
7	PDB:7tbyA	0.558	0.742	0.000	1788	0.346	0.471	7tbyA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
8	PDB:7w01A	0.513	0.756	0.000	1598	0.241	0.367	7w01A.pdb.gz
9	AFDB:A0A0G2K1Q8	0.554	0.774	0.000	1704	0.246	0.352	A0A0G2K1Q8.pdb.gz	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
10	AFDB:B8A446	0.672	0.719	0.000	2268	0.382	0.410	B8A446.pdb.gz	B8A446_DANRE ATP-binding cassette sub-family A member 1 OS=Danio rerio OX=7955 GN=abca1 PE=4 SV=1
11	AFDB:E9PWH4	0.538	0.764	0.000	1668	0.218	0.318	E9PWH4.pdb.gz	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
12	AFDB:E9PX95	0.550	0.755	0.000	1733	0.225	0.316	E9PX95.pdb.gz	ABCAH_MOUSE ATP-binding cassette sub-family A member 17 OS=Mus musculus OX=10090 GN=Abca17 PE=1 SV=1
13	AFDB:E9Q876	0.691	0.650	0.000	2595	0.306	0.287	E9Q876.pdb.gz	ABCAC_MOUSE Glucosylceramide transporter ABCA12 OS=Mus musculus OX=10090 GN=Abca12 PE=1 SV=1
14	AFDB:O35600	0.664	0.697	0.000	2310	0.369	0.389	O35600.pdb.gz	ABCA4_MOUSE Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=1 SV=1
15	AFDB:O95477	0.689	0.739	0.000	2261	0.391	0.421	O95477.pdb.gz	ABCA1_HUMAN Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3
16	AFDB:P78363	0.668	0.714	0.000	2273	0.356	0.381	P78363.pdb.gz	ABCA4_HUMAN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3
17	AFDB:Q7TNJ2	0.671	0.749	0.000	2170	0.350	0.393	Q7TNJ2.pdb.gz	ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1
18	AFDB:Q84M24	0.529	0.673	0.000	1882	0.224	0.290	Q84M24.pdb.gz	AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCA1 PE=2 SV=2
19	PDB:7w02A	0.507	0.762	3.483E-104	1566	0.237	0.368	7w02A.pdb.gz	Cryo-EM structures of the human surfactant lipid transporter ABCA3.
20	PDB:7m1qA	0.562	0.702	3.570E-102	1911	0.312	0.398	7m1qA.pdb.gz	Cryo-EM structures of the ABCA4 importer reveal mechanisms underlying substrate binding and Stargardt disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WXK5	4989	2466	0.991	0.979	A0A087WXK5_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens OX=9606 GN=ABCA2 PE=1 SV=1
2	A0A8I5ZLK5	759	2263	0.167	0.180	A0A8I5ZLK5_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=1
3	A0A8I6ATT1	1514	2190	0.361	0.401	A0A8I6ATT1_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=1
4	B2RY11	1070	2595	0.275	0.258	B2RY11_MOUSE Abca12 protein OS=Mus musculus OX=10090 GN=Abca12 PE=2 SV=1
5	B2RY21	1072	2595	0.275	0.258	B2RY21_MOUSE Abca12 protein OS=Mus musculus OX=10090 GN=Abca12 PE=2 SV=1
6	B8A446	736	2268	0.158	0.169	B8A446_DANRE ATP-binding cassette sub-family A member 1 OS=Danio rerio OX=7955 GN=abca1 PE=4 SV=1
7	E9Q876	1072	2595	0.275	0.258	ABCAC_MOUSE Glucosylceramide transporter ABCA12 OS=Mus musculus OX=10090 GN=Abca12 PE=1 SV=1
8	F1LNL3	1506	2201	0.360	0.398	F1LNL3_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=4
9	F1MWM0	696	2281	0.171	0.182	ABCA4_BOVIN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Bos taurus OX=9913 GN=ABCA4 PE=1 SV=2
10	K9J4V5	1524	2262	0.361	0.389	K9J4V5_PIG ATP-binding cassette sub-family A member 1 OS=Sus scrofa OX=9823 GN=ABCA1 PE=2 SV=1
11	O35600	698	2310	0.172	0.181	ABCA4_MOUSE Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=1 SV=1
12	O95477	1543	2261	0.367	0.395	ABCA1_HUMAN Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3
13	P41233	1527	2261	0.360	0.388	ABCA1_MOUSE Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4
14	P41234	4375	2434	0.908	0.908	ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus OX=10090 GN=Abca2 PE=1 SV=4
15	P78363	668	2273	0.152	0.163	ABCA4_HUMAN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3
16	Q7TNJ2	649	2170	0.143	0.160	ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1
17	Q80ZB2	758	2201	0.167	0.185	Q80ZB2_RAT ATP-binding cassette 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=2 SV=1
18	Q86UK0	1032	2595	0.268	0.251	ABCAC_HUMAN Glucosylceramide transporter ABCA12 OS=Homo sapiens OX=9606 GN=ABCA12 PE=1 SV=3
19	Q8IZY2	650	2146	0.146	0.166	ABCA7_HUMAN Phospholipid-transporting ATPase ABCA7 OS=Homo sapiens OX=9606 GN=ABCA7 PE=1 SV=3
20	Q91V24	617	2159	0.148	0.167	ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus OX=10090 GN=Abca7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	26	15.8	AAA ATPase domain
2	PF13304 AAA_21	3.4e-14	64.9	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13476 AAA_23	1.6e+02	14.2	AAA domain
4	PF12698 ABC2_membrane_3	2.1e-54	196.5	ABC-2 family transporter protein
5	PF00005 ABC_tran	1e-52	189.7	ABC transporter
6	PF13558 SbcC_Walker_B	3.2e+02	13.0	SbcC/RAD50-like, Walker B motif
7	PF00448 SRP54	5.9e+02	11.5	SRP54-type protein, GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344155

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349396	0.938	ATP-binding cassette sub-family D member 4
2	9606.ENSP00000265316	0.928	ATP-binding cassette sub-family B member 6, mitochondrial
3	9606.ENSP00000260645	0.921	ATP-binding cassette sub-family G member 5
4	9606.ENSP00000272286	0.919	ATP-binding cassette sub-family G member 8
5	9606.ENSP00000297504	0.810	ATP-binding cassette sub-family B member 8, mitochondrial
6	9606.ENSP00000263980	0.755	Sodium/hydrogen exchanger 1
7	9606.ENSP00000444688	0.754	Sodium/potassium-transporting ATPase subunit alpha-3
8	9606.ENSP00000481244	0.744	Phospholemman
9	9606.ENSP00000354490	0.743	Sodium/potassium-transporting ATPase subunit alpha-2
10	9606.ENSP00000445306	0.743	Sodium/potassium-transporting ATPase subunit alpha-1
11	9606.ENSP00000218548	0.741	Potassium-transporting ATPase alpha chain 2
12	9606.ENSP00000356790	0.740	Sodium/potassium-transporting ATPase subunit beta-1
13	9606.ENSP00000440045	0.740	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
14	9606.ENSP00000250111	0.726	Sodium/potassium-transporting ATPase subunit beta-2
15	9606.ENSP00000286371	0.726	Sodium/potassium-transporting ATPase subunit beta-3
16	9606.ENSP00000296149	0.721	Elongator complex protein 6
17	9606.ENSP00000303960	0.720	ATP-binding cassette sub-family C member 8
18	9606.ENSP00000350132	0.720	Cardiac phospholamban
19	9606.ENSP00000412388	0.693	Uncharacterized protein C9orf172
20	9606.ENSP00000285238	0.684	Canalicular multispecific organic anion transporter 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	0.998	ATP-dependent activity
GO:0005215	0.998	transporter activity
GO:0005524	0.998	ATP binding
GO:0005319	0.994	lipid transporter activity
GO:0022857	0.975	transmembrane transporter activity
GO:0140303	0.964	intramembrane lipid transporter activity
GO:0005515	0.949	protein binding
GO:0140326	0.912	ATPase-coupled intramembrane lipid transporter activity
GO:0022804	0.829	active transmembrane transporter activity
GO:0042626	0.776	ATPase-coupled transmembrane transporter activity
GO:0046624	0.716	sphingolipid transporter activity
GO:0098772	0.499	molecular function regulator activity
GO:0061135	0.433	endopeptidase regulator activity
GO:0003824	0.318	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0051246	0.982	regulation of protein metabolic process
GO:0032879	0.977	regulation of localization
GO:0009889	0.975	regulation of biosynthetic process
GO:0051179	0.970	localization
GO:0031323	0.967	regulation of cellular metabolic process
GO:0006810	0.958	transport
GO:0008152	0.957	metabolic process
GO:0071840	0.940	cellular component organization or biogenesis
GO:1902991	0.939	regulation of amyloid precursor protein catabolic process
GO:0071704	0.936	organic substance metabolic process
GO:0051051	0.933	negative regulation of transport
GO:0032501	0.924	multicellular organismal process
GO:0071702	0.922	organic substance transport
GO:0019216	0.918	regulation of lipid metabolic process
GO:0045806	0.914	negative regulation of endocytosis
GO:0044237	0.902	cellular metabolic process
GO:0032371	0.888	regulation of sterol transport
GO:0032374	0.878	regulation of cholesterol transport
GO:0044238	0.876	primary metabolic process
GO:0016043	0.864	cellular component organization
GO:0048518	0.858	positive regulation of biological process
GO:1901564	0.858	organonitrogen compound metabolic process
GO:0034248	0.853	regulation of amide metabolic process
GO:0048259	0.848	regulation of receptor-mediated endocytosis
GO:0022010	0.842	central nervous system myelination
GO:0031326	0.829	regulation of cellular biosynthetic process
GO:0010556	0.827	regulation of macromolecule biosynthetic process
GO:0033036	0.819	macromolecule localization
GO:0065009	0.812	regulation of molecular function
GO:0050896	0.804	response to stimulus
GO:0010876	0.778	lipid localization
GO:0065008	0.758	regulation of biological quality
GO:0048522	0.735	positive regulation of cellular process
GO:0006869	0.715	lipid transport
GO:0019220	0.694	regulation of phosphate metabolic process
GO:0048261	0.690	negative regulation of receptor-mediated endocytosis
GO:0009892	0.658	negative regulation of metabolic process
GO:0006629	0.630	lipid metabolic process
GO:0045833	0.612	negative regulation of lipid metabolic process
GO:0034250	0.592	positive regulation of amide metabolic process
GO:0044092	0.568	negative regulation of molecular function
GO:0051055	0.566	negative regulation of lipid biosynthetic process
GO:0044085	0.550	cellular component biogenesis
GO:1903725	0.531	regulation of phospholipid metabolic process
GO:0019218	0.530	regulation of steroid metabolic process
GO:0061024	0.527	membrane organization
GO:1902003	0.526	regulation of amyloid-beta formation
GO:0071071	0.519	regulation of phospholipid biosynthetic process
GO:0006665	0.518	sphingolipid metabolic process
GO:0044087	0.512	regulation of cellular component biogenesis
GO:0010604	0.493	positive regulation of macromolecule metabolic process
GO:1903018	0.465	regulation of glycoprotein metabolic process
GO:0051716	0.461	cellular response to stimulus
GO:0010559	0.460	regulation of glycoprotein biosynthetic process
GO:0032386	0.451	regulation of intracellular transport
GO:0042592	0.446	homeostatic process
GO:0031399	0.446	regulation of protein modification process
GO:0045936	0.446	negative regulation of phosphate metabolic process
GO:0042221	0.445	response to chemical
GO:0044281	0.425	small molecule metabolic process
GO:0051247	0.406	positive regulation of protein metabolic process
GO:0048878	0.400	chemical homeostasis
GO:0051172	0.370	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031090	0.990	organelle membrane
GO:0071944	0.987	cell periphery
GO:0012505	0.986	endomembrane system
GO:0005886	0.984	plasma membrane
GO:0098588	0.976	bounding membrane of organelle
GO:0031982	0.940	vesicle
GO:0005773	0.884	vacuole
GO:0005764	0.833	lysosome
GO:0098852	0.790	lytic vacuole membrane
GO:0005765	0.776	lysosomal membrane
GO:0031410	0.739	cytoplasmic vesicle
GO:0070013	0.346	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	0.912	P-type phospholipid transporter.
EC:7.-.-.-	0.778	Translocases.

[back to server]