StarFunc result for job id Q9BZE9

User Input

>input (553 residues)
MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPCEYDLKFQRSVLD
LSLQWRFANLPNNAKLEMVPASRSREGPENMVRIALQLDDGSRLQDSFCSGQTLWELLSH
FPQIRECLQHPGGATPVCVYTRDEVTGEAALRGTTLQSLGLTGGSATIRFVMKCYDPVGK
TPGSLGSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAA
PFVPFSGGGQRLGGPPGPTRPLTSSSAKLPKSLSSPGGPSKPKKSKSGQDPQQEQEQERE
RDPQQEQERERPVDREPVDREPVVCHPDLEERLQAWPAELPDEFFELTVDDVRRRLAQLK
SERKRLEEAPLVTKAFREAQIKEKLERYPKVALRVLFPDRYVLQGFFRPSETVGDLRDFV
RSHLGNPELSFYLFITPPKTVLDDHTQTLFQANLFPAALVHLGAEEPAGVYLEPGLLEHA
ISPSAADVLVARYMSRAAGSPSPLPAPDPAPKSEPAAEEGALVPPEPIPGTAQPVKRSLG
KVPKWLKLPASKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BZE9	1.000	1.000	5.486E-103	553	1.000	1.000	Q9BZE9.pdb.gz	ASPC1_HUMAN Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1 PE=1 SV=1
2	AFDB:Q8VBT9	0.560	0.563	2.974E-84	550	0.796	0.800	Q8VBT9.pdb.gz	ASPC1_MOUSE Tether containing UBX domain for GLUT4 OS=Mus musculus OX=10090 GN=Aspscr1 PE=1 SV=1
3	AFDB:Q54X06	0.396	0.385	1.027E-31	573	0.195	0.188	Q54X06.pdb.gz	Q54X06_DICDI UBX domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279285 PE=4 SV=1
4	AFDB:Q9LK22	0.269	0.574	8.696E-15	251	0.116	0.255	Q9LK22.pdb.gz	PUX1_ARATH Plant UBX domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PUX1 PE=1 SV=1
5	AFDB:Q9BZV1	0.262	0.325	8.564E-12	441	0.096	0.120	Q9BZV1.pdb.gz	UBXN6_HUMAN UBX domain-containing protein 6 OS=Homo sapiens OX=9606 GN=UBXN6 PE=1 SV=1
6	AFDB:P63072	0.137	0.422	6.649E-9	162	0.027	0.093	P63072.pdb.gz	UBD_MOUSE Ubiquitin D OS=Mus musculus OX=10090 GN=Ubd PE=1 SV=1
7	AFDB:E7F568	0.120	0.057	7.488E-9	1343	0.165	0.068	E7F568.pdb.gz	COBL_DANRE Protein cordon-bleu OS=Danio rerio OX=7955 GN=cobl PE=1 SV=2
8	PDB:6yvaC	0.205	0.558	2.036E-8	155	0.047	0.168	6yvaC.pdb.gz
9	AFDB:Q5NBX1	0.116	0.051	2.767E-8	1337	0.092	0.038	Q5NBX1.pdb.gz	COBL_MOUSE Protein cordon-bleu OS=Mus musculus OX=10090 GN=Cobl PE=1 SV=1
10	AFDB:Q53SF7	0.111	0.058	2.937E-8	1128	0.108	0.053	Q53SF7.pdb.gz	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
11	PDB:7rbsB	0.199	0.540	5.932E-8	157	0.034	0.121	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
12	PDB:6mdhA	0.145	0.419	2.620E-7	149	0.045	0.168	6mdhA.pdb.gz
13	AFDB:Q92575	0.142	0.154	4.517E-7	508	0.119	0.130	Q92575.pdb.gz	UBXN4_HUMAN UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2
14	PDB:6hd0D	0.131	0.918	1.653E-6	75	0.049	0.360	6hd0D.pdb.gz	Common Mode of Remodeling AAA ATPases p97/CDC48 by Their Disassembling Cofactors ASPL/PUX1.
15	PDB:6pyuA	0.116	0.073	2.128E-5	930	0.043	0.026	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
16	PDB:7lq1A	0.121	0.073	2.396E-5	950	0.043	0.025	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
17	PDB:3dbhI	0.131	0.749	3.225E-5	86	0.022	0.140	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
18	PDB:5swpA	0.124	0.067	6.200E-5	1060	0.051	0.026	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
19	PDB:5dxhD	0.125	0.072	8.344E-5	981	0.047	0.027	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
20	PDB:5itdA	0.124	0.071	8.855E-5	995	0.049	0.027	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KRY8	0.0	701	353	0.638	1.000	J3KRY8_HUMAN ASPSCR1 tether for SLC2A4, UBX domain containing (Fragment) OS=Homo sapiens OX=9606 GN=ASPSCR1 PE=1 SV=2
2	J3QL04	0.0	560	307	0.499	0.899	J3QL04_HUMAN ASPSCR1 tether for SLC2A4, UBX domain containing (Fragment) OS=Homo sapiens OX=9606 GN=ASPSCR1 PE=1 SV=1
3	Q8VBT9	0.0	780	550	0.774	0.778	ASPC1_MOUSE Tether containing UBX domain for GLUT4 OS=Mus musculus OX=10090 GN=Aspscr1 PE=1 SV=1
4	Q9BZE9	0.0	1112	553	1.000	1.000	ASPC1_HUMAN Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1 PE=1 SV=1
5	Q9LK22	1.98e-18	87.4	251	0.116	0.255	PUX1_ARATH Plant UBX domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PUX1 PE=1 SV=1
6	Q54X06	1.58e-12	72.4	573	0.083	0.080	Q54X06_DICDI UBX domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279285 PE=4 SV=1
7	Q9ZU93	4.57e-11	67.4	458	0.085	0.103	PUX2_ARATH Plant UBX domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=PUX2 PE=1 SV=2
8	Q9BZV1	5.50e-10	63.9	441	0.081	0.102	UBXN6_HUMAN UBX domain-containing protein 6 OS=Homo sapiens OX=9606 GN=UBXN6 PE=1 SV=1
9	Q7K0S5	8.85e-10	63.2	441	0.080	0.100	Q7K0S5_DROME GDI interacting protein 3, isoform B OS=Drosophila melanogaster OX=7227 GN=Gint3 PE=1 SV=1
10	Q8WTJ4	0.002	43.5	437	0.069	0.087	UBXN6_CAEEL UBX domain-containing protein 6 OS=Caenorhabditis elegans OX=6239 GN=ubxn-6 PE=1 SV=2
11	P54730	0.003	42.7	416	0.094	0.125	UBX4_YEAST UBX domain-containing protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBX4 PE=1 SV=1
12	Q14152	0.080	38.5	1382	0.061	0.025	EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1
13	Q9UNZ2	1.1	34.3	370	0.108	0.162	NSF1C_HUMAN NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2
14	Q8IDX6	2.0	33.9	3130	0.065	0.012	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
15	Q96EB1	2.4	33.5	424	0.033	0.042	ELP4_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=2
16	A0A1W2PNY5	2.8	33.1	386	0.033	0.047	A0A1W2PNY5_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=1
17	A0A1W2PRF5	2.8	33.1	475	0.033	0.038	A0A1W2PRF5_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=1
18	Q20497	3.0	33.5	3498	0.029	0.005	MED12_CAEEL Mediator of RNA polymerase II transcription subunit 12 OS=Caenorhabditis elegans OX=6239 GN=dpy-22 PE=1 SV=2
19	A0A1W2PQZ6	3.4	32.7	392	0.033	0.046	A0A1W2PQZ6_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=1
20	A0A1W2PRF0	3.4	32.7	395	0.033	0.046	A0A1W2PRF0_HUMAN Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18525 Cas9_C	76	15.0	Cas9 C-terminal domain
2	PF02196 RBD	11	17.3	Raf-like Ras-binding domain
3	PF11470 TUG-UBL1	8.8e-21	85.2	TUG ubiquitin-like domain
4	PF00789 UBX	2.4e-07	42.2	UBX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008954731.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003829865.1	0.884	Valosin containing protein
2	9597.XP_003806466.1	0.844	UBX domain-containing protein 7
3	9597.XP_008971934.1	0.789	Zinc finger protein 384 isoform X1
4	9597.XP_008975034.1	0.762	DEK proto-oncogene
5	9597.XP_003830708.1	0.756	MLLT3, super elongation complex subunit
6	9597.XP_008954757.1	0.751	NPL4 homolog, ubiquitin recognition factor
7	9597.XP_003821313.1	0.719	NSFL1 cofactor p47 isoform X1
8	9597.XP_003814093.1	0.692	Ubiquitin fusion degradation 1 like (yeast)
9	9597.XP_003822022.1	0.688	UBX domain protein 2B
10	9597.XP_008950624.1	0.688	UBX domain protein 2A
11	9597.XP_008970882.1	0.688	UBX domain protein 6
12	9597.XP_003830744.1	0.684	Phospholipase A2 activating protein
13	9597.XP_008952147.1	0.677	UBX domain-containing protein 1 isoform X1
14	9597.XP_008961764.1	0.675	Fanconi anemia group C protein isoform X1
15	9597.XP_008959921.1	0.668	UBX domain-containing protein 11 isoform X1
16	9597.XP_003816447.1	0.646	Spermatogenesis associated 5
17	9597.XP_003827066.1	0.646	ATPase family, AAA domain containing 2B
18	9597.XP_008955117.1	0.646	Belongs to the AAA ATPase family.
19	9597.XP_003806885.1	0.641	FAS-associated factor 2
20	9597.XP_003813054.1	0.632	Belongs to the MYST (SAS/MOZ) family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0051171	0.946	regulation of nitrogen compound metabolic process
GO:0060255	0.926	regulation of macromolecule metabolic process
GO:0048518	0.924	positive regulation of biological process
GO:0080090	0.872	regulation of primary metabolic process
GO:0009987	0.734	cellular process
GO:0051246	0.656	regulation of protein metabolic process
GO:0009893	0.648	positive regulation of metabolic process
GO:0010604	0.619	positive regulation of macromolecule metabolic process
GO:0050794	0.607	regulation of cellular process
GO:0051173	0.583	positive regulation of nitrogen compound metabolic process
GO:0031399	0.575	regulation of protein modification process
GO:0051247	0.446	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005654	0.997	nucleoplasm
GO:0005737	0.782	cytoplasm
GO:0005829	0.363	cytosol
GO:0012505	0.332	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]