StarFunc result for job id Q9BZF1

User Input

>input (889 residues)
MEGGLADGEPDRTSLLGDSKDVLGPSTVVANSDESQLLTPGKMSQRQGKEAYPTPTKDLH
QPSLSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLYNGSEKDSSTSSKLTKKES
LKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYK
TQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPS
SYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRA
NNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEVMGKSEESDTDTSER
QDDSYIEPEPVEPLKETTYTEQSHEELGEAGEASQTETVSEENKSLIWTLLKQVRPGMDL
SKVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRLKKVVKWYLSGFYKKPKGL
KKPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRKDGFCLSGSILAKS
KFYGNSLSAILEGEARLTFLNRGEDYVMTMPYAHCKGILYGTMTLELGGTVNITCQKTGY
SAILEFKLKPFLGSSDCVNQISGKLKLGKEVLATLEGHWDSEVFITDKKTDNSEVFWNPT
PDIKQWRLIRHTVKFEEQGDFESEKLWQRVTRAINAKDQTEATQEKYVLEEAQRQAARDR
KTKNEEWSCKLFELDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVP
KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQT
QEEIKRNIMALRNHLVSSTPATDYFLQQKDYFIIFLLILLQVIINFMFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B9EJ86	0.504	0.504	0.000	889	0.960	0.960	B9EJ86.pdb.gz	OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus OX=10090 GN=Osbpl8 PE=1 SV=1
2	AFDB:Q8MPR9	0.600	0.687	8.168E-82	770	0.412	0.475	Q8MPR9.pdb.gz	Q8MPR9_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=obr-3 PE=1 SV=1
3	AFDB:Q9BXB5	0.385	0.445	5.541E-42	764	0.200	0.233	Q9BXB5.pdb.gz	OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens OX=9606 GN=OSBPL10 PE=1 SV=2
4	AFDB:A0A140VJQ6	0.375	0.443	1.043E-39	747	0.190	0.226	A0A140VJQ6.pdb.gz	A0A140VJQ6_HUMAN Oxysterol-binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:Q9UUA1	0.391	0.714	9.252E-37	479	0.165	0.307	Q9UUA1.pdb.gz	YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC23B6.01c PE=1 SV=2
6	AFDB:Q9UW25	0.379	0.768	9.675E-35	433	0.147	0.303	Q9UW25.pdb.gz	OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OBPA PE=3 SV=1
7	AFDB:Q9UW21	0.387	0.789	1.565E-34	429	0.144	0.298	Q9UW21.pdb.gz	OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OBPALPHA PE=3 SV=1
8	AFDB:P38755	0.373	0.749	9.633E-34	437	0.143	0.291	P38755.pdb.gz	OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSH7 PE=1 SV=1
9	AFDB:Q02201	0.377	0.737	1.477E-33	448	0.139	0.277	Q02201.pdb.gz	OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSH6 PE=1 SV=1
10	PDB:4ph7D	0.377	0.807	4.889E-32	407	0.135	0.295	4ph7D.pdb.gz	INTRACELLULAR TRANSPORT. Phosphatidylserine transport by ORP/Osh proteins is driven by phosphatidylinositol 4-phosphate.
11	AFDB:O74178	0.366	0.807	1.226E-27	388	0.128	0.294	O74178.pdb.gz	KES1_SCHPO Protein kes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kes1 PE=2 SV=2
12	PDB:5zm8A	0.313	0.693	1.444E-22	386	0.120	0.277	5zm8A.pdb.gz	ORP2 Delivers Cholesterol to the Plasma Membrane in Exchange for Phosphatidylinositol 4, 5-Bisphosphate (PI(4,5)P2).
13	PDB:5zm8B	0.321	0.664	4.437E-22	413	0.126	0.271	5zm8B.pdb.gz	ORP2 Delivers Cholesterol to the Plasma Membrane in Exchange for Phosphatidylinositol 4, 5-Bisphosphate (PI(4,5)P2).
14	PDB:3spwA	0.314	0.674	3.763E-21	398	0.111	0.249	3spwA.pdb.gz	Osh4p exchanges sterols for phosphatidylinositol 4-phosphate between lipid bilayers.
15	PDB:4jchA	0.329	0.641	2.719E-20	436	0.116	0.236	4jchA.pdb.gz	Structure of OSH4 bound to an electrophilic oxysterol
16	PDB:6bbpA	0.120	0.200	3.342E-6	520	0.036	0.062	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
17	PDB:6u3eA	0.115	0.245	2.057E-5	397	0.029	0.065	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:4mk0A	0.112	0.154	2.279E-4	631	0.025	0.035	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:3ljuX	0.095	0.218	2.536E-4	373	0.019	0.046	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
20	PDB:7rx9A	0.109	0.217	9.146E-4	432	0.017	0.035	7rx9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B9EJ86	0.0	1751	889	0.961	0.961	OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus OX=10090 GN=Osbpl8 PE=1 SV=1
2	G5EC19	0.0	664	733	0.412	0.499	G5EC19_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=obr-3 PE=1 SV=1
3	Q8MPR9	0.0	660	770	0.409	0.473	Q8MPR9_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=obr-3 PE=1 SV=1
4	Q9BZF1	0.0	1840	889	1.000	1.000	OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3
5	Q9H0X9	0.0	951	879	0.531	0.537	OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens OX=9606 GN=OSBPL5 PE=1 SV=1
6	Q9UUA1	8.44e-78	263	479	0.154	0.286	YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC23B6.01c PE=1 SV=2
7	Q9UW25	4.98e-69	238	433	0.143	0.293	OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OBPA PE=3 SV=1
8	Q96SU4	3.35e-67	240	736	0.165	0.200	OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens OX=9606 GN=OSBPL9 PE=1 SV=2
9	Q9UW21	3.17e-65	227	429	0.143	0.296	OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OBPALPHA PE=3 SV=1
10	Q8I7N6	8.82e-63	219	400	0.159	0.352	Q8I7N6_CAEEL Oxysterol-binding protein OS=Caenorhabditis elegans OX=6239 GN=obr-4 PE=1 SV=1
11	P38755	1.86e-62	219	437	0.143	0.291	OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSH7 PE=1 SV=1
12	O01686	1.88e-61	223	676	0.180	0.237	O01686_CAEEL Oxysterol-binding protein OS=Caenorhabditis elegans OX=6239 GN=obr-4 PE=1 SV=2
13	Q02201	7.92e-60	213	448	0.136	0.270	OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSH6 PE=1 SV=1
14	Q9BXB5	1.47e-59	219	764	0.163	0.190	OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens OX=9606 GN=OSBPL10 PE=1 SV=2
15	A0A140VJQ6	4.69e-59	218	747	0.145	0.173	A0A140VJQ6_HUMAN Oxysterol-binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
16	Q9BXB4	4.69e-59	218	747	0.145	0.173	OSB11_HUMAN Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2
17	O74178	1.36e-35	141	388	0.116	0.265	KES1_SCHPO Protein kes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kes1 PE=2 SV=2
18	Q9BXW6	6.57e-32	136	950	0.127	0.119	OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens OX=9606 GN=OSBPL1A PE=1 SV=2
19	Q91XL9	7.88e-32	136	950	0.127	0.119	OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus OX=10090 GN=Osbpl1a PE=1 SV=2
20	Q8K4M9	2.63e-31	134	950	0.125	0.117	OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus OX=10116 GN=Osbpl1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01237 Oxysterol_BP	2.2e-87	304.9	Oxysterol-binding protein
2	PF00169 PH	1.3e-07	43.5	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261183

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000471191	0.839	Nuclear pore glycoprotein p62
2	9606.ENSP00000373713	0.819	Phosphatidylinositide phosphatase SAC1
3	9606.ENSP00000260385	0.752	Regulator of microtubule dynamics protein 3
4	9606.ENSP00000349687	0.682	Ganglioside GM2 activator
5	9606.ENSP00000339730	0.678	Thrombospondin-4
6	9606.ENSP00000358363	0.671	Myomegalin
7	9606.ENSP00000262554	0.660	Serine palmitoyltransferase 1
8	9606.ENSP00000460070	0.658	General transcription factor II-I
9	9606.ENSP00000355180	0.619	Collagen alpha-1(VI) chain
10	9606.ENSP00000345656	0.603	Vesicle-associated membrane protein-associated protein A
11	9606.ENSP00000251527	0.597	Extended synaptotagmin-2
12	9606.ENSP00000348772	0.592	Membrane-associated phosphatidylinositol transfer protein 1
13	9606.ENSP00000389168	0.591	Protein phosphatase 1 regulatory subunit 12A
14	9606.ENSP00000357869	0.586	Phosphatidylinositol 4-kinase beta
15	9606.ENSP00000417175	0.572	Vesicle-associated membrane protein-associated protein B/C
16	9606.ENSP00000387617	0.571	Single-pass membrane protein with coiled-coil domains 2
17	9606.ENSP00000267113	0.553	Extended synaptotagmin-1
18	9606.ENSP00000234313	0.547	Pleckstrin
19	9606.ENSP00000403397	0.535	Palmitoyltransferase ZDHHC17
20	9606.ENSP00000255882	0.533	Phosphatidylinositol 4-kinase alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0120013	0.999	lipid transfer activity
GO:1901981	0.999	phosphatidylinositol phosphate binding
GO:0005548	0.998	phospholipid transporter activity
GO:0015485	0.995	cholesterol binding
GO:0070273	0.992	phosphatidylinositol-4-phosphate binding
GO:0001786	0.981	phosphatidylserine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.994	regulation of biological process
GO:0071704	0.985	organic substance metabolic process
GO:0044238	0.983	primary metabolic process
GO:0044237	0.978	cellular metabolic process
GO:0006869	0.970	lipid transport
GO:0006629	0.963	lipid metabolic process
GO:0046486	0.947	glycerolipid metabolic process
GO:0006650	0.927	glycerophospholipid metabolic process
GO:0050794	0.918	regulation of cellular process
GO:0015914	0.907	phospholipid transport
GO:0032879	0.877	regulation of localization
GO:0048518	0.823	positive regulation of biological process
GO:0006807	0.808	nitrogen compound metabolic process
GO:0048519	0.778	negative regulation of biological process
GO:1901564	0.766	organonitrogen compound metabolic process
GO:1905952	0.743	regulation of lipid localization
GO:0032502	0.723	developmental process
GO:0030154	0.651	cell differentiation
GO:0019222	0.636	regulation of metabolic process
GO:0048522	0.580	positive regulation of cellular process
GO:0006575	0.564	cellular modified amino acid metabolic process
GO:0051049	0.514	regulation of transport
GO:0031323	0.460	regulation of cellular metabolic process
GO:0048583	0.455	regulation of response to stimulus
GO:0010883	0.429	regulation of lipid storage
GO:0045444	0.420	fat cell differentiation
GO:1905953	0.400	negative regulation of lipid localization
GO:0080090	0.343	regulation of primary metabolic process
GO:0023051	0.326	regulation of signaling
GO:0010646	0.326	regulation of cell communication
GO:0009893	0.326	positive regulation of metabolic process
GO:0060255	0.325	regulation of macromolecule metabolic process
GO:0051171	0.323	regulation of nitrogen compound metabolic process
GO:0009966	0.321	regulation of signal transduction
GO:0051641	0.304	cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.987	cytosol
GO:0005634	0.986	nucleus
GO:0071944	0.974	cell periphery
GO:0031090	0.957	organelle membrane
GO:0005886	0.927	plasma membrane
GO:0005783	0.848	endoplasmic reticulum
GO:0031984	0.839	organelle subcompartment
GO:0098827	0.785	endoplasmic reticulum subcompartment
GO:0005635	0.698	nuclear envelope
GO:0042175	0.559	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.541	endoplasmic reticulum membrane
GO:0043233	0.511	organelle lumen
GO:0070013	0.504	intracellular organelle lumen
GO:0031965	0.470	nuclear membrane
GO:0005938	0.415	cell cortex
GO:0031981	0.368	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]