StarFunc result for job id Q9BZF9

User Input

>input (1416 residues)
MKSLKSRLRRQDVPGPASSGAAAASAHAADWNKYDDRLMKAAERGDVEKVTSILAKKGVN
PGKLDVEGRSVFHVVTSKGNLECLNAILIHGVDITTSDTAGRNALHLAAKYGHALCLQKL
LQYNCPTEHADLQGRTALHDAAMADCPSSIQLLCDHGASVNAKDVDGRTPLVLATQMSRP
TICQLLIDRGADVNSRDKQNRTALMLGCEYGCRDAVEVLIKNGADISLLDALGHDSSYYA
RIGDNLDILTLLKTASENTNKGRELWKKGPSLQQRNLTHMQDEVNVKSHQREHQNIQDLE
IENEDLKERLRKIQQEQRILLDKVNGLQLQLNEEVMVADDLESEREKLKSLLAAKEKQHE
ESLRTIEALKNRFKYFESDHLGSGSHFSNRKEDMLLKQGQMYMADSQCTSPGIPAHMQSR
SMLRPLELSLPSQTSYSENEILKKELEAMRTFCESAKQDRLKLQNELAHKVAECKALALE
CERVKEDSDEQIKQLEDALKDVQKRMYESEGKVKQMQTHFLALKEHLTSEAASGNHRLTE
ELKDQLKDLKVKYEGASAEVGKLRNQIKQNEMIVEEFKRDEGKLIEENKRLQKELSMCEM
EREKKGRKVTEMEGQAKELSAKLALSIPAEKFENMKSSLSNEVNEKAKKLVEMEREHEKS
LSEIRQLKRELENVKAKLAQHVKPEEHEQVKSRLEQKSGELGKKITELTLKNQTLQKEIE
KVYLDNKLLKEQAHNLTIEMKNHYVPLKVSEDMKKSHDAIIDDLNRKLLDVTQKYTEKKL
EMEKLLLENDSLSKDVSRLETVFVPPEKHEKEIIALKSNIVELKKQLSELKKKCGEDQEK
IHALTSENTNLKKMMSNQYVPVKTHEEVKMTLNDTLAKTNRELLDVKKKFEDINQEFVKI
KDKNEILKRNLENTQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEI
VTLHAEIKAQKKELDTIQECIKVKYAPIVSFEECERKFKATEKELKDQLSEQTQKYSVSE
EEVKKNKQENDKLKKEIFTLQKDLRDKTVLIEKSHEMERALSRKTDELNKQLKDLSQKYT
EVKNVKEKLVEENAKQTSEILAVQNLLQKQHVPLEQVEALKKSLNGTIENLKEELKSMQR
CYEKEQQTVTKLHQLLENQKNSSVPLAEHLQIKEAFEKEVGIIKASLREKEEESQNKMEE
VSKLQSEVQNTKQALKKLETREVVDLSKYKATKSDLETQISSLNEKLANLNRKYEEVCEE
VLHAKKKEISAKDEKELLHFSIEQEIKDQKERCDKSLTTITELQRRIQESAKQIEAKDNK
ITELLNDVERLKQALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLADADRQHQEV
IAIYRTHLLSAAQGHMDEDVQEALLQIIQMRQGLVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CGB3	0.314	0.315	0.000	1411	0.789	0.792	Q8CGB3.pdb.gz	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
2	AFDB:Q9BZF9	1.000	1.000	0.000	1416	1.000	1.000	Q9BZF9.pdb.gz	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
3	AFDB:Q9EP71	0.169	0.242	9.610E-31	979	0.234	0.338	Q9EP71.pdb.gz	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
4	AFDB:Q69ZU8	0.141	0.264	5.341E-16	712	0.087	0.173	Q69ZU8.pdb.gz	ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2
5	AFDB:Q5TYW2	0.156	0.266	1.515E-15	823	0.097	0.168	Q5TYW2.pdb.gz	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
6	AFDB:Q8UVC1	0.136	0.183	1.585E-15	1021	0.066	0.091	Q8UVC1.pdb.gz	INVS_DANRE Inversin OS=Danio rerio OX=7955 GN=invs PE=2 SV=1
7	AFDB:A1A5B0	0.160	0.687	1.988E-15	309	0.050	0.230	A1A5B0.pdb.gz	A1A5B0_HUMAN ANKRD36 protein OS=Homo sapiens OX=9606 GN=ANKRD36 PE=1 SV=1
8	AFDB:Q54KA7	0.153	0.219	4.923E-15	986	0.046	0.066	Q54KA7.pdb.gz	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
9	AFDB:O89019	0.151	0.201	9.717E-15	1062	0.068	0.090	O89019.pdb.gz	INVS_MOUSE Inversin OS=Mus musculus OX=10090 GN=Invs PE=1 SV=2
10	AFDB:A0A0R4IA11	0.154	0.381	1.017E-14	563	0.045	0.114	A0A0R4IA11.pdb.gz
11	PDB:8cs9A	0.149	0.265	3.693E-12	796	0.039	0.069	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.152	0.894	3.404E-11	229	0.040	0.245	2dvwA.pdb.gz
13	PDB:4oauC	0.131	0.243	4.892E-11	692	0.049	0.100	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:5vkqA	0.133	0.127	1.519E-10	1499	0.047	0.044	5vkqA.pdb.gz
15	PDB:1wg0A	0.149	0.791	6.194E-10	243	0.044	0.259	1wg0A.pdb.gz
16	PDB:6jd6B	0.116	0.799	2.413E-9	192	0.034	0.250	6jd6B.pdb.gz
17	PDB:6v9hC	0.140	0.701	5.456E-9	270	0.032	0.170	6v9hC.pdb.gz
18	PDB:6mwqA	0.103	0.281	3.196E-8	493	0.040	0.116	6mwqA.pdb.gz
19	PDB:1bd8A	0.098	0.714	4.390E-8	156	0.034	0.308	1bd8A.pdb.gz
20	PDB:6aunA	0.143	0.316	6.309E-8	618	0.037	0.084	6aunA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5H2B9	0.0	2341	1307	0.868	0.940	F5H2B9_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=1
2	H0YNH8	0.0	2789	1401	0.980	0.991	H0YNH8_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=1
3	Q8CGB3	0.0	2265	1411	0.791	0.794	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
4	Q9BZF9	0.0	2859	1416	1.000	1.000	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
5	Q9P0K7	7.25e-77	278	980	0.087	0.126	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
6	Q9EP71	1.10e-75	275	979	0.086	0.125	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
7	Q8N8A2	1.02e-19	98.6	993	0.051	0.073	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
8	Q9ULJ7	2.13e-19	97.8	1429	0.049	0.048	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
9	Q5TYW2	2.52e-19	97.1	823	0.040	0.069	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
10	F8W2M1	4.67e-19	96.3	904	0.037	0.059	HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio OX=7955 GN=hace1 PE=3 SV=2
11	O89019	1.20e-18	95.1	1062	0.047	0.063	INVS_MOUSE Inversin OS=Mus musculus OX=10090 GN=Invs PE=1 SV=2
12	Q8IYU2	1.70e-18	94.4	909	0.037	0.058	HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens OX=9606 GN=HACE1 PE=1 SV=2
13	Q12955	1.94e-18	94.7	4377	0.047	0.015	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
14	Q8GZ22	4.48e-18	87.4	240	0.050	0.296	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
15	Q9Y283	1.01e-17	92.0	1065	0.045	0.060	INVS_HUMAN Inversin OS=Homo sapiens OX=9606 GN=INVS PE=1 SV=2
16	Q17490	1.41e-17	92.0	6994	0.039	0.008	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
17	O70511	2.53e-17	91.3	2622	0.047	0.025	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
18	A0A5F9ZHR8	4.08e-17	90.5	3939	0.036	0.013	A0A5F9ZHR8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZHS1	4.26e-17	90.5	3984	0.036	0.013	A0A5F9ZHS1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZGY3	4.40e-17	90.5	3934	0.036	0.013	A0A5F9ZGY3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.7e-16	69.9	Ankyrin repeat
2	PF12796 Ank_2	1.2e-35	133.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.9e-17	71.8	Ankyrin repeat
4	PF13637 Ank_4	2.1e-18	77.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	8.8e-20	81.8	Ankyrin repeats (many copies)
6	PF15619 Lebercilin	2.2	19.4	Ciliary protein causing Leber congenital amaurosis disease
7	PF05557 MAD	2	18.3	Mitotic checkpoint protein
8	PF16331 TolA_bind_tri	8.4	17.8	TolA binding protein trimerisation
9	PF00261 Tropomyosin	19	16.0	Tropomyosin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314556

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000448165	0.874	Apoptotic protease-activating factor 1
2	9606.ENSP00000330237	0.779	Caspase-9
3	9606.ENSP00000307786	0.755	Cytochrome c
4	9606.ENSP00000254301	0.733	Galectin-3
5	9606.ENSP00000368984	0.652	Exosome complex component RRP45
6	9606.ENSP00000258083	0.595	Protease-associated domain-containing protein 1
7	9606.ENSP00000338727	0.557	Leucine-rich repeat flightless-interacting protein 2
8	9606.ENSP00000328088	0.555	PRKC apoptosis WT1 regulator protein
9	9606.ENSP00000344855	0.524	F-box/LRR-repeat protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.994	biological regulation
GO:0009987	0.994	cellular process
GO:0050794	0.976	regulation of cellular process
GO:0019222	0.867	regulation of metabolic process
GO:0060255	0.780	regulation of macromolecule metabolic process
GO:0050896	0.736	response to stimulus
GO:0051171	0.724	regulation of nitrogen compound metabolic process
GO:0080090	0.722	regulation of primary metabolic process
GO:0048519	0.705	negative regulation of biological process
GO:0048518	0.701	positive regulation of biological process
GO:0051716	0.691	cellular response to stimulus
GO:0051179	0.677	localization
GO:0048523	0.645	negative regulation of cellular process
GO:0051246	0.637	regulation of protein metabolic process
GO:0048522	0.636	positive regulation of cellular process
GO:0007165	0.625	signal transduction
GO:0065009	0.582	regulation of molecular function
GO:0008104	0.562	protein localization
GO:0009893	0.528	positive regulation of metabolic process
GO:0051173	0.513	positive regulation of nitrogen compound metabolic process
GO:0010604	0.504	positive regulation of macromolecule metabolic process
GO:0048583	0.501	regulation of response to stimulus
GO:0050790	0.460	regulation of catalytic activity
GO:0043067	0.385	regulation of programmed cell death
GO:0012501	0.381	programmed cell death
GO:0051247	0.369	positive regulation of protein metabolic process
GO:0008152	0.356	metabolic process
GO:0035556	0.343	intracellular signal transduction
GO:0042981	0.329	regulation of apoptotic process
GO:0051336	0.325	regulation of hydrolase activity
GO:0044093	0.318	positive regulation of molecular function
GO:0060341	0.312	regulation of cellular localization
GO:0071704	0.307	organic substance metabolic process
GO:0030162	0.305	regulation of proteolysis
GO:0006915	0.304	apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.997	nucleoplasm
GO:0070062	0.494	extracellular exosome
GO:0016020	0.427	membrane
GO:0032991	0.342	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]